StarFunc result for job id Q9BPX6

User Input

>input (476 residues)
MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRAHAESP
PCVDNLKSDIGDKGKNKDEGDVCNHEKKTADLAPHPEEKKKKRSGFRDRKVMEYENRIRA
YSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKK
ISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDM
EEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQ
RKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLT
FQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALF
DCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286YF11	0.827	0.817	4.408E-68	482	1.000	0.988	A0A286YF11.pdb.gz	A0A286YF11_HUMAN Mitochondrial calcium uptake 1 OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
2	PDB:6xjxQ	0.725	0.932	1.150E-44	367	0.769	0.997	6xjxQ.pdb.gz
3	AFDB:A2VEI2	0.750	0.682	1.599E-44	525	0.475	0.430	A2VEI2.pdb.gz	MICU1_DROME Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MICU1 PE=2 SV=1
4	PDB:6k7yI	0.520	0.777	1.439E-30	306	0.637	0.990	6k7yI.pdb.gz	Structure of intact human MCU supercomplex with the auxiliary MICU subunits.
5	AFDB:Q9SZ45	0.573	0.551	2.103E-19	498	0.269	0.257	Q9SZ45.pdb.gz	MICU_ARATH Calcium uptake protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MICU PE=2 SV=1
6	AFDB:Q8CD10	0.512	0.559	2.850E-18	432	0.225	0.248	Q8CD10.pdb.gz	MICU2_MOUSE Calcium uptake protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Micu2 PE=1 SV=2
7	AFDB:Q8IYU8	0.516	0.560	7.621E-18	434	0.218	0.240	Q8IYU8.pdb.gz	MICU2_HUMAN Calcium uptake protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=MICU2 PE=1 SV=2
8	AFDB:Q86XE3	0.522	0.474	2.606E-17	530	0.267	0.240	Q86XE3.pdb.gz	MICU3_HUMAN Calcium uptake protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=MICU3 PE=1 SV=1
9	PDB:6iihA	0.479	0.508	3.308E-14	446	0.170	0.182	6iihA.pdb.gz	The crystal structure of MICU2 provides insight into Ca2+binding and MICU1-MICU2 heterodimer formation.
10	AFDB:Q581Z7	0.523	0.599	3.629E-13	410	0.149	0.173	Q581Z7.pdb.gz	Q581Z7_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.270 PE=4 SV=1
11	AFDB:Q4QIT3	0.480	0.634	4.725E-11	345	0.147	0.203	Q4QIT3.pdb.gz	Q4QIT3_LEIMA EF-hand domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_07_0110 PE=4 SV=1
12	AFDB:A8DWJ8	0.126	0.061	7.903E-3	1340	0.122	0.043	A8DWJ8.pdb.gz	A8DWJ8_DROME NADPH oxidase, isoform C OS=Drosophila melanogaster OX=7227 GN=Nox PE=4 SV=1
13	PDB:2f33A	0.142	0.233	1.597E-2	261	0.084	0.153	2f33A.pdb.gz
14	PDB:2f2pA	0.120	0.266	2.881E-2	169	0.074	0.207	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
15	PDB:2be4A	0.134	0.207	3.179E-2	270	0.082	0.144	2be4A.pdb.gz
16	PDB:3fwbA	0.132	0.306	3.179E-2	153	0.065	0.203	3fwbA.pdb.gz
17	PDB:1hqvA	0.127	0.297	3.685E-2	178	0.057	0.152	1hqvA.pdb.gz	Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
18	PDB:4il1A	0.114	0.107	4.486E-2	529	0.059	0.053	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
19	PDB:1jfkA	0.126	0.353	4.949E-2	134	0.069	0.246	1jfkA.pdb.gz	NMR derived solution structure of an EF-hand calcium-binding protein from Entamoeba Histolytica.
20	AFDB:A0A077K8G3	0.084	0.092	3.009E-1	407	0.111	0.130	A0A077K8G3.pdb.gz	CGT1A_CITLI Coumarin 8-geranyltransferase 1, chloroplastic OS=Citrus limon OX=2708 GN=ClPT1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RRK1	0.0	986	480	1.000	0.992	A0A0U1RRK1_HUMAN Mitochondrial calcium uptake 1 OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
2	A0A286YF11	0.0	986	482	1.000	0.988	A0A286YF11_HUMAN Mitochondrial calcium uptake 1 OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
3	Q8VCX5	0.0	926	477	0.929	0.927	MICU1_MOUSE Calcium uptake protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Micu1 PE=1 SV=1
4	Q9BPX6	0.0	993	476	1.000	1.000	MICU1_HUMAN Calcium uptake protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MICU1 PE=1 SV=1
5	A2VEI2	2.02e-147	433	525	0.454	0.411	MICU1_DROME Calcium uptake protein 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MICU1 PE=2 SV=1
6	Q9SZ45	1.27e-46	170	498	0.242	0.231	MICU_ARATH Calcium uptake protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MICU PE=2 SV=1
7	Q86XE3	2.02e-39	151	530	0.218	0.196	MICU3_HUMAN Calcium uptake protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=MICU3 PE=1 SV=1
8	Q8CD10	7.95e-35	137	432	0.216	0.238	MICU2_MOUSE Calcium uptake protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Micu2 PE=1 SV=2
9	Q8IYU8	5.22e-34	134	434	0.185	0.203	MICU2_HUMAN Calcium uptake protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=MICU2 PE=1 SV=2
10	Q581Z7	7.14e-12	69.3	410	0.145	0.168	Q581Z7_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.270 PE=4 SV=1
11	Q8BH59	9.70e-08	57.0	677	0.181	0.127	S2512_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1
12	O75746	1.32e-07	56.6	678	0.179	0.125	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
13	Q4QIT3	2.44e-07	55.1	345	0.143	0.197	Q4QIT3_LEIMA EF-hand domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_07_0110 PE=4 SV=1
14	Q57YA6	1.59e-06	52.8	456	0.082	0.086	Q57YA6_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.490 PE=4 SV=1
15	Q9UJS0	3.18e-06	52.0	675	0.118	0.083	S2513_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2
16	F1LX07	5.21e-06	51.2	676	0.118	0.083	S2512_RAT Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a12 PE=3 SV=5
17	Q9QXX4	1.50e-05	50.1	676	0.113	0.080	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
18	Q9VA73	1.51e-04	46.6	695	0.172	0.118	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
19	Q7L5N7	0.071	38.1	544	0.048	0.042	PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1
20	P40482	0.17	37.0	926	0.065	0.033	SEC24_YEAST Protein transport protein SEC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC24 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00404 Dockerin_1	82	14.8	Dockerin type I domain
2	PF20196 DUF6559	1.4e+02	14.0	Family of unknown function (DUF6559)
3	PF00036 EF-hand_1	5.2e-09	46.1	EF hand
4	PF12763 EF-hand_4	0.27	22.5	Cytoskeletal-regulatory complex EF hand
5	PF13202 EF-hand_5	7.8e-06	36.3	EF hand
6	PF13405 EF-hand_6	7.9e-08	42.5	EF-hand domain
7	PF13499 EF-hand_7	0.00017	33.3	EF-hand domain pair
8	PF13833 EF-hand_8	5.7e-05	34.1	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354415

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327467	0.999	Essential MCU regulator, mitochondrial
2	9606.ENSP00000362144	0.999	Calcium uniporter protein, mitochondrial
3	9606.ENSP00000371811	0.998	Calcium uptake protein 2, mitochondrial
4	9606.ENSP00000378145	0.998	Calcium uniporter regulatory subunit MCUb, mitochondrial
5	9606.ENSP00000368468	0.966	Mitochondrial calcium uniporter regulator 1
6	9606.ENSP00000321455	0.909	Calcium uptake protein 3, mitochondrial
7	9606.ENSP00000447091	0.884	Mitochondrial sodium/calcium exchanger protein
8	9606.ENSP00000305653	0.872	Mitochondrial proton/calcium exchanger protein
9	9606.ENSP00000295767	0.851	Mitochondrial intermembrane space import and assembly protein 40
10	9606.ENSP00000301454	0.780	Calcium-binding mitochondrial carrier protein SCaMC-3
11	9606.ENSP00000268704	0.777	Paraplegin
12	9606.ENSP00000357097	0.768	High affinity immunoglobulin epsilon receptor subunit alpha
13	9606.ENSP00000269143	0.765	AFG3-like protein 2
14	9606.ENSP00000441875	0.687	Prohibitin-2
15	9606.ENSP00000478059	0.679	Stromal interaction molecule 1
16	9606.ENSP00000479488	0.662	Prohibitin
17	9606.ENSP00000295079	0.650	m-AAA protease-interacting protein 1, mitochondrial
18	9606.ENSP00000378265	0.643	Sodium/hydrogen exchanger 9B2
19	9606.ENSP00000377390	0.642	Serine/threonine-protein phosphatase 6 regulatory subunit 3
20	9606.ENSP00000265333	0.622	Voltage-dependent anion-selective channel protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0046982	1.000	protein heterodimerization activity
GO:0005509	1.000	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0051179	0.987	localization
GO:0050789	0.985	regulation of biological process
GO:0070588	0.983	calcium ion transmembrane transport
GO:1990542	0.973	mitochondrial transmembrane transport
GO:0051560	0.970	mitochondrial calcium ion homeostasis
GO:0048583	0.962	regulation of response to stimulus
GO:0071840	0.875	cellular component organization or biogenesis
GO:0016043	0.867	cellular component organization
GO:1901000	0.856	regulation of response to salt stress
GO:0050794	0.808	regulation of cellular process
GO:0050896	0.744	response to stimulus
GO:0006851	0.386	mitochondrial calcium ion transmembrane transport
GO:0070509	0.384	calcium ion import
GO:0006950	0.375	response to stress
GO:0036444	0.365	calcium import into the mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.986	membrane
GO:0032991	0.841	protein-containing complex
GO:0031090	0.827	organelle membrane
GO:0005740	0.800	mitochondrial envelope
GO:0098796	0.704	membrane protein complex
GO:0031966	0.567	mitochondrial membrane
GO:1902495	0.477	transmembrane transporter complex
GO:0034702	0.425	ion channel complex
GO:0034704	0.423	calcium channel complex
GO:0005743	0.417	mitochondrial inner membrane
GO:0070013	0.392	intracellular organelle lumen
GO:0098798	0.377	mitochondrial protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]