StarFunc result for job id Q9BPZ2

User Input

>input (258 residues)
MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKE
GDEPITQWKGTVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHIS
DANLANTIIGKAVEHMFEGEHGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDD
YKEGDLRIMPESSESPPTEREPGGVVDGLIGKHVEYTKEDGSKRIGMVIHQVEAKPSVYF
IKFDDDFHIYVYDLVKKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9W1	0.850	0.850	1.987E-45	258	0.996	0.996	A0A024R9W1.pdb.gz
2	AFDB:A0A024R297	0.830	0.817	1.095E-39	262	0.783	0.771	A0A024R297.pdb.gz
3	AFDB:Q5JUX0	0.815	0.815	1.194E-38	258	0.744	0.744	Q5JUX0.pdb.gz	SPIN3_HUMAN Spindlin-3 OS=Homo sapiens OX=9606 GN=SPIN3 PE=1 SV=1
4	AFDB:Q56A73	0.778	0.806	9.928E-35	249	0.636	0.659	Q56A73.pdb.gz	SPIN4_HUMAN Spindlin-4 OS=Homo sapiens OX=9606 GN=SPIN4 PE=1 SV=1
5	PDB:2ns2A	0.756	0.966	1.879E-33	201	0.655	0.841	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
6	PDB:2ns2B	0.656	0.979	6.771E-28	172	0.570	0.855	2ns2B.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
7	AFDB:A0A087X074	0.252	0.397	2.331E-18	157	0.605	0.994	A0A087X074.pdb.gz	A0A087X074_HUMAN Spindlin family member 2A OS=Homo sapiens OX=9606 GN=SPIN2A PE=3 SV=1
8	AFDB:O94875	0.156	0.053	1.180E-5	1100	0.132	0.031	O94875.pdb.gz	SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3
9	AFDB:Q62417	0.154	0.042	5.692E-4	1290	0.120	0.024	Q62417.pdb.gz	SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sorbs1 PE=1 SV=2
10	AFDB:O60504	0.157	0.074	6.002E-4	671	0.109	0.042	O60504.pdb.gz	VINEX_HUMAN Vinexin OS=Homo sapiens OX=9606 GN=SORBS3 PE=1 SV=2
11	AFDB:F4JP43	0.164	0.029	4.280E-3	2037	0.128	0.016	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
12	PDB:3mh5A	0.145	0.175	6.006E-3	191	0.058	0.079	3mh5A.pdb.gz	HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
13	PDB:2p4bB	0.120	0.119	7.832E-3	260	0.081	0.081	2p4bB.pdb.gz
14	PDB:7okyZ	0.210	0.158	1.077E-2	374	0.097	0.067	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
15	AFDB:P40442	0.147	0.058	1.530E-2	995	0.074	0.019	P40442.pdb.gz	CSS1_YEAST Secreted protein CSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSS1 PE=2 SV=1
16	PDB:1te0A	0.123	0.103	2.265E-2	318	0.140	0.113	1te0A.pdb.gz
17	PDB:3pv2B	0.141	0.114	2.518E-2	388	0.151	0.101	3pv2B.pdb.gz
18	PDB:6tedZ	0.141	0.081	2.801E-2	510	0.078	0.039	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
19	PDB:1zq1A	0.209	0.133	3.463E-2	437	0.066	0.039	1zq1A.pdb.gz	Structural Basis for tRNA-Dependent Amidotransferase Function
20	PDB:1ky9B	0.127	0.094	5.889E-2	396	0.070	0.045	1ky9B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JZB8	0.0	515	247	0.957	1.000	Q5JZB8_HUMAN Spindlin-2B (Fragment) OS=Homo sapiens OX=9606 GN=SPIN2B PE=1 SV=1
2	Q99865	0.0	535	258	0.996	0.996	SPI2A_HUMAN Spindlin-2A OS=Homo sapiens OX=9606 GN=SPIN2A PE=1 SV=3
3	Q9BPZ2	0.0	537	258	1.000	1.000	SPI2B_HUMAN Spindlin-2B OS=Homo sapiens OX=9606 GN=SPIN2B PE=1 SV=1
4	Q9Y657	1.68e-150	422	262	0.783	0.771	SPIN1_HUMAN Spindlin-1 OS=Homo sapiens OX=9606 GN=SPIN1 PE=1 SV=3
5	Q90WG2	3.69e-150	421	262	0.787	0.775	SPINW_CHICK Spindlin-W OS=Gallus gallus OX=9031 GN=SPINW PE=2 SV=1
6	Q61142	4.03e-150	421	262	0.779	0.767	SPIN1_MOUSE Spindlin-1 OS=Mus musculus OX=10090 GN=Spin1 PE=1 SV=2
7	Q5JUX0	9.66e-149	417	258	0.744	0.744	SPIN3_HUMAN Spindlin-3 OS=Homo sapiens OX=9606 GN=SPIN3 PE=1 SV=1
8	Q56A73	3.71e-119	342	249	0.628	0.651	SPIN4_HUMAN Spindlin-4 OS=Homo sapiens OX=9606 GN=SPIN4 PE=1 SV=1
9	Q5JZB7	2.15e-54	174	157	0.322	0.529	Q5JZB7_HUMAN Spindlin family member 2B OS=Homo sapiens OX=9606 GN=SPIN2B PE=1 SV=1
10	A0A087X074	9.32e-54	172	157	0.318	0.522	A0A087X074_HUMAN Spindlin family member 2A OS=Homo sapiens OX=9606 GN=SPIN2A PE=3 SV=1
11	Q9HAP2	6.8	30.8	919	0.097	0.027	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
12	X2JF83	9.9	30.0	5101	0.047	0.002	X2JF83_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02513 Spin-Ssty	1.4e-72	250.5	Spin/Ssty Family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365019	0.817	Spindlin-1
2	9606.ENSP00000362135	0.779	YrdC domain-containing protein, mitochondrial
3	9606.ENSP00000294244	0.747	SPIN1-docking protein
4	9606.ENSP00000381429	0.747	CGG triplet repeat-binding protein 1
5	9606.ENSP00000353735	0.603	E3 ubiquitin-protein ligase Topors

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	1.000	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.979	organic substance metabolic process
GO:0044238	0.978	primary metabolic process
GO:0044237	0.976	cellular metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0043170	0.968	macromolecule metabolic process
GO:0050794	0.966	regulation of cellular process
GO:0016043	0.959	cellular component organization
GO:0046483	0.947	heterocycle metabolic process
GO:1901360	0.946	organic cyclic compound metabolic process
GO:0019222	0.939	regulation of metabolic process
GO:0090304	0.933	nucleic acid metabolic process
GO:0016070	0.923	RNA metabolic process
GO:0010467	0.920	gene expression
GO:0060255	0.911	regulation of macromolecule metabolic process
GO:0080090	0.889	regulation of primary metabolic process
GO:0051171	0.889	regulation of nitrogen compound metabolic process
GO:0048518	0.888	positive regulation of biological process
GO:0006355	0.874	regulation of DNA-templated transcription
GO:0006351	0.866	DNA-templated transcription
GO:0034660	0.818	ncRNA metabolic process
GO:0006996	0.803	organelle organization
GO:0007276	0.797	gamete generation
GO:0098781	0.780	ncRNA transcription
GO:0007143	0.704	female meiotic nuclear division
GO:0048522	0.679	positive regulation of cellular process
GO:0051173	0.564	positive regulation of nitrogen compound metabolic process
GO:0010604	0.561	positive regulation of macromolecule metabolic process
GO:0048583	0.497	regulation of response to stimulus
GO:0023051	0.471	regulation of signaling
GO:0010646	0.452	regulation of cell communication
GO:0009303	0.415	rRNA transcription
GO:0030111	0.404	regulation of Wnt signaling pathway
GO:0045893	0.346	positive regulation of DNA-templated transcription
GO:0023056	0.323	positive regulation of signaling
GO:0010647	0.323	positive regulation of cell communication
GO:0048584	0.322	positive regulation of response to stimulus
GO:0009967	0.300	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.940	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]