StarFunc result for job id Q9BPZ7

User Input

>input (522 residues)
MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGE
TQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQEL
KSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVY
LPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGE
VDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVT
MKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRAD
GVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS
TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVL
KVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BKH7	0.760	0.760	2.543E-90	522	0.971	0.971	Q8BKH7.pdb.gz	SIN1_MOUSE Target of rapamycin complex 2 subunit MAPKAP1 OS=Mus musculus OX=10090 GN=Mapkap1 PE=1 SV=1
2	AFDB:E7EZP2	0.551	0.547	2.530E-80	527	0.828	0.820	E7EZP2.pdb.gz	E7EZP2_DANRE Target of rapamycin complex 2 subunit MAPKAP1 OS=Danio rerio OX=7955 GN=mapkap1 PE=1 SV=2
3	AFDB:A0A024R863	0.334	0.352	2.484E-77	486	0.931	1.000	A0A024R863.pdb.gz
4	AFDB:Q9V719	0.269	0.253	4.104E-31	569	0.274	0.251	Q9V719.pdb.gz	SIN1_DROME Stress-activated map kinase-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=Sin1 PE=1 SV=1
5	AFDB:Q9NA80	0.251	0.208	4.261E-28	642	0.226	0.184	Q9NA80.pdb.gz	SIN1_CAEEL Stress-activated map kinase-interacting protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=sinh-1 PE=3 SV=3
6	AFDB:Q9P7Y9	0.222	0.186	1.995E-23	665	0.213	0.167	Q9P7Y9.pdb.gz	SIN1_SCHPO Target of rapamycin complex 2 subunit sin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sin1 PE=1 SV=1
7	AFDB:J9W0F7	0.240	0.164	6.800E-22	796	0.195	0.128	J9W0F7.pdb.gz	J9W0F7_CRYNH Uncharacterized protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_04693 PE=3 SV=2
8	AFDB:Q9Y0C9	0.182	0.117	2.392E-16	838	0.157	0.098	Q9Y0C9.pdb.gz	RIP3_DICDI Ras-interacting protein RIP3 OS=Dictyostelium discoideum OX=44689 GN=ripA PE=1 SV=1
9	PDB:7vvbB	0.146	0.952	4.829E-11	77	0.148	1.000	7vvbB.pdb.gz	Structural insights into Ras regulation by SIN1.
10	PDB:7c3mA	0.147	0.134	1.032E-6	577	0.061	0.055	7c3mA.pdb.gz
11	AFDB:Q55GG3	0.170	0.118	1.798E-6	818	0.096	0.061	Q55GG3.pdb.gz	Q55GG3_DICDI Ubiquitin-like domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268498 PE=4 SV=2
12	PDB:6yvaC	0.128	0.401	2.992E-6	155	0.050	0.168	6yvaC.pdb.gz
13	AFDB:Q9QZA1	0.165	0.206	5.211E-6	407	0.052	0.066	Q9QZA1.pdb.gz	PHLA1_RAT Pleckstrin homology-like domain family A member 1 OS=Rattus norvegicus OX=10116 GN=Phlda1 PE=2 SV=2
14	PDB:4yknA	0.135	0.061	1.436E-5	1205	0.059	0.026	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
15	PDB:7rbsB	0.129	0.391	1.698E-5	157	0.054	0.178	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
16	PDB:7lq1A	0.150	0.085	2.009E-5	950	0.077	0.042	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
17	PDB:4rm8A	0.140	0.191	6.889E-5	368	0.092	0.130	4rm8A.pdb.gz
18	PDB:2y3aA	0.157	0.089	1.140E-4	976	0.079	0.042	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
19	PDB:5swpA	0.141	0.073	2.234E-4	1060	0.065	0.032	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
20	PDB:6pyuA	0.156	0.091	3.126E-4	930	0.075	0.042	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EZP2	0.0	858	527	0.822	0.814	E7EZP2_DANRE Target of rapamycin complex 2 subunit MAPKAP1 OS=Danio rerio OX=7955 GN=mapkap1 PE=1 SV=2
2	Q8BKH7	0.0	1065	522	0.971	0.971	SIN1_MOUSE Target of rapamycin complex 2 subunit MAPKAP1 OS=Mus musculus OX=10090 GN=Mapkap1 PE=1 SV=1
3	Q9BPZ7	0.0	1088	522	1.000	1.000	SIN1_HUMAN Target of rapamycin complex 2 subunit MAPKAP1 OS=Homo sapiens OX=9606 GN=MAPKAP1 PE=1 SV=2
4	Q9V719	1.17e-30	127	569	0.178	0.163	SIN1_DROME Stress-activated map kinase-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=Sin1 PE=1 SV=1
5	Q9NA80	1.97e-22	103	642	0.140	0.114	SIN1_CAEEL Stress-activated map kinase-interacting protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=sinh-1 PE=3 SV=3
6	J9W0F7	7.19e-13	73.6	796	0.080	0.053	J9W0F7_CRYNH Uncharacterized protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_04693 PE=3 SV=2
7	Q9P7Y9	2.47e-11	68.6	665	0.090	0.071	SIN1_SCHPO Target of rapamycin complex 2 subunit sin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sin1 PE=1 SV=1
8	A2QCP4	1.97e-10	65.9	838	0.130	0.081	A2QCP4_ASPNC Contig An02c0120, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An02g04280 PE=3 SV=1
9	Q9Y0C9	0.006	42.0	838	0.036	0.023	RIP3_DICDI Ras-interacting protein RIP3 OS=Dictyostelium discoideum OX=44689 GN=ripA PE=1 SV=1
10	Q9JJR5	0.25	35.8	212	0.046	0.113	AKIP1_MOUSE A-kinase-interacting protein 1 OS=Mus musculus OX=10090 GN=Akip1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16978 CRIM	9.1e-32	121.5	SAPK-interacting protein 1 (Sin1), middle CRIM domain
2	PF18091 E3_UbLigase_RBR	27	16.3	E3 Ubiquitin Ligase RBR C-terminal domain
3	PF05422 SIN1	4.7e-30	116.5	Stress-activated map kinase interacting protein 1 (SIN1)
4	PF16979 SIN1_PH	7.6e-24	95.5	SAPK-interacting protein 1 (Sin1), Pleckstrin-homology
5	PF02204 VPS9	28	16.3	Vacuolar sorting protein 9 (VPS9) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000009807

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000013019	0.998	RPTOR independent companion of MTOR, complex 2
2	60711.ENSCSAP00000007097	0.993	MTOR associated protein, LST8 homolog (S. cerevisiae)
3	60711.ENSCSAP00000017216	0.993	Serine/threonine-protein kinase mTOR
4	60711.ENSCSAP00000005949	0.950	V-akt murine thymoma viral oncogene homolog 1
5	60711.ENSCSAP00000012788	0.916	Belongs to the protein kinase superfamily.
6	60711.ENSCSAP00000006977	0.896	DEP domain containing MTOR-interacting protein
7	60711.ENSCSAP00000002497	0.877	Belongs to the BolA/IbaG family.
8	60711.ENSCSAP00000004196	0.877	SMG1, nonsense mediated mRNA decay associated PI3K related kinase
9	60711.ENSCSAP00000010957	0.877	Belongs to the PI3/PI4-kinase family.
10	60711.ENSCSAP00000005583	0.871	V-akt murine thymoma viral oncogene homolog 3
11	60711.ENSCSAP00000007256	0.844	Tuberous sclerosis 2
12	60711.ENSCSAP00000000122	0.841	V-akt murine thymoma viral oncogene homolog 2
13	60711.ENSCSAP00000002198	0.833	Ribosomal protein S6 kinase, 70kDa, polypeptide 1
14	60711.ENSCSAP00000010287	0.816	Belongs to the protein kinase superfamily.
15	60711.ENSCSAP00000000466	0.793	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
16	60711.ENSCSAP00000011107	0.777	Tuberous sclerosis 1
17	60711.ENSCSAP00000001990	0.773	Rho GTPase activating protein 1
18	60711.ENSCSAP00000004858	0.773	Ribosomal protein S6 kinase, 70kDa, polypeptide 2
19	60711.ENSCSAP00000015731	0.758	Regulatory associated protein of MTOR, complex 1
20	60711.ENSCSAP00000010184	0.741	Belongs to the protein kinase superfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.512	molecular function regulator activity
GO:0019899	0.405	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0048583	0.970	regulation of response to stimulus
GO:0031323	0.950	regulation of cellular metabolic process
GO:0048518	0.949	positive regulation of biological process
GO:0032502	0.938	developmental process
GO:0080090	0.910	regulation of primary metabolic process
GO:0048856	0.899	anatomical structure development
GO:0044237	0.896	cellular metabolic process
GO:0032501	0.893	multicellular organismal process
GO:0010646	0.875	regulation of cell communication
GO:0023051	0.874	regulation of signaling
GO:0009966	0.852	regulation of signal transduction
GO:0048522	0.842	positive regulation of cellular process
GO:0051171	0.834	regulation of nitrogen compound metabolic process
GO:0060255	0.826	regulation of macromolecule metabolic process
GO:1902531	0.791	regulation of intracellular signal transduction
GO:0007275	0.774	multicellular organism development
GO:0048519	0.743	negative regulation of biological process
GO:0051246	0.732	regulation of protein metabolic process
GO:0048523	0.697	negative regulation of cellular process
GO:0050896	0.675	response to stimulus
GO:0071704	0.671	organic substance metabolic process
GO:0044238	0.631	primary metabolic process
GO:0019220	0.627	regulation of phosphate metabolic process
GO:0031399	0.621	regulation of protein modification process
GO:0080134	0.594	regulation of response to stress
GO:0009893	0.564	positive regulation of metabolic process
GO:0006793	0.556	phosphorus metabolic process
GO:0006796	0.540	phosphate-containing compound metabolic process
GO:0042325	0.495	regulation of phosphorylation
GO:1902882	0.488	regulation of response to oxidative stress
GO:0001932	0.481	regulation of protein phosphorylation
GO:0016310	0.480	phosphorylation
GO:0006807	0.474	nitrogen compound metabolic process
GO:0031325	0.464	positive regulation of cellular metabolic process
GO:0010604	0.444	positive regulation of macromolecule metabolic process
GO:0051716	0.423	cellular response to stimulus
GO:1901564	0.401	organonitrogen compound metabolic process
GO:0007154	0.386	cell communication
GO:0023052	0.377	signaling
GO:0043170	0.367	macromolecule metabolic process
GO:0019538	0.359	protein metabolic process
GO:0007165	0.355	signal transduction
GO:0010648	0.319	negative regulation of cell communication
GO:0051247	0.306	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.998	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0016020	0.997	membrane
GO:0071944	0.994	cell periphery
GO:0140535	0.993	intracellular protein-containing complex
GO:0012505	0.986	endomembrane system
GO:0005886	0.963	plasma membrane
GO:0038201	0.958	TOR complex
GO:0031932	0.938	TORC2 complex
GO:0043232	0.339	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]