StarFunc result for job id Q9BQ04

User Input

>input (359 residues)
MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRT
GRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYKRYRVRSYEAVAAAAAASA
YNYAEQTMSHLPQVQSTTVTSHLNSTSVDPYDRHLLPNSGAAATSAAMAAAAATTSSYYG
RDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSLYDMARYEREQYVDRARYSAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VE92	0.635	0.638	1.264E-61	357	0.964	0.969	Q8VE92.pdb.gz	RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus OX=10090 GN=Rbm4b PE=1 SV=1
2	AFDB:Q9BWF3	0.509	0.502	2.867E-56	364	0.903	0.890	Q9BWF3.pdb.gz	RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1
3	AFDB:Q803F7	0.390	0.366	8.618E-34	385	0.493	0.460	Q803F7.pdb.gz	Q803F7_DANRE RNA binding motif protein 4 like OS=Danio rerio OX=7955 GN=rbm4l PE=1 SV=1
4	AFDB:Q94901	0.335	0.341	7.994E-29	352	0.326	0.332	Q94901.pdb.gz	LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster OX=7227 GN=lark PE=1 SV=1
5	AFDB:F6NL73	0.217	0.171	1.231E-21	484	0.270	0.200	F6NL73.pdb.gz
6	AFDB:A0A0S2Z4Z0	0.227	0.124	8.921E-21	669	0.306	0.164	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
7	AFDB:A0A0B4KHI4	0.214	0.104	8.841E-17	761	0.242	0.114	A0A0B4KHI4.pdb.gz	A0A0B4KHI4_DROME Syncrip, isoform Q OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
8	AFDB:Q08170	0.197	0.144	3.606E-16	494	0.214	0.156	Q08170.pdb.gz	SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2
9	AFDB:Q802Y1	0.200	0.196	4.097E-16	366	0.192	0.189	Q802Y1.pdb.gz	Q802Y1_DANRE Serine and arginine-rich-splicing factor 4 OS=Danio rerio OX=7955 GN=zgc:55809 PE=1 SV=1
10	AFDB:Q01560	0.225	0.205	2.970E-15	414	0.167	0.145	Q01560.pdb.gz	NOP3_YEAST Serine/arginine (SR)-type shuttling mRNA binding protein NPL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPL3 PE=1 SV=1
11	PDB:5lsbA	0.205	0.396	4.522E-12	176	0.097	0.199	5lsbA.pdb.gz
12	PDB:7oqcF	0.204	0.270	7.073E-12	267	0.120	0.161	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:6y53o	0.189	0.416	1.623E-11	160	0.097	0.219	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:6y5qq	0.204	0.381	1.962E-10	178	0.084	0.169	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:5vsuA	0.191	0.177	6.197E-10	387	0.078	0.072	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
16	PDB:7evoD	0.213	0.363	1.516E-9	200	0.084	0.150	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6ff7X	0.191	0.395	3.471E-8	171	0.075	0.158	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:6r5kH	0.197	0.180	8.491E-8	394	0.100	0.091	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
19	PDB:5yzg1	0.192	0.281	1.711E-6	243	0.081	0.119	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:7dvqY	0.199	0.497	1.944E-6	140	0.067	0.171	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C7Q4	0.0	617	361	0.886	0.881	RBM4_MOUSE RNA-binding protein 4 OS=Mus musculus OX=10090 GN=Rbm4 PE=1 SV=1
2	Q8VE92	0.0	719	357	0.964	0.969	RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus OX=10090 GN=Rbm4b PE=1 SV=1
3	Q9BQ04	0.0	749	359	1.000	1.000	RBM4B_HUMAN RNA-binding protein 4B OS=Homo sapiens OX=9606 GN=RBM4B PE=1 SV=1
4	Q9BWF3	0.0	622	364	0.894	0.882	RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1
5	F1Q7F8	1.05e-96	294	384	0.510	0.477	F1Q7F8_DANRE RNA binding motif protein 4 like isoform X1 OS=Danio rerio OX=7955 GN=Rbm4 PE=1 SV=1
6	Q803F7	1.03e-95	291	385	0.504	0.470	Q803F7_DANRE RNA binding motif protein 4 like OS=Danio rerio OX=7955 GN=rbm4l PE=1 SV=1
7	Q94901	5.19e-59	196	352	0.245	0.250	LARK_DROME RNA-binding protein lark OS=Drosophila melanogaster OX=7227 GN=lark PE=1 SV=1
8	A0A0R4IJ04	3.01e-49	175	556	0.228	0.147	A0A0R4IJ04_DANRE RNA binding motif protein 14 isoform X3 OS=Danio rerio OX=7955 GN=rbm14 PE=1 SV=2
9	Q6NV05	3.34e-49	175	556	0.228	0.147	Q6NV05_DANRE RNA binding motif protein 14 OS=Danio rerio OX=7955 GN=zgc:85696 PE=1 SV=1
10	A0A0S2Z4Z0	4.56e-41	154	669	0.203	0.109	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
11	Q96PK6	4.56e-41	154	669	0.203	0.109	RBM14_HUMAN RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2
12	Q8C2Q3	2.65e-40	152	669	0.201	0.108	RBM14_MOUSE RNA-binding protein 14 OS=Mus musculus OX=10090 GN=Rbm14 PE=1 SV=1
13	Q503D7	5.57e-39	146	471	0.306	0.234	Q503D7_DANRE RNA binding motif protein 14 OS=Danio rerio OX=7955 GN=zgc:110682 PE=1 SV=1
14	Q10667	3.92e-18	85.9	305	0.114	0.134	RNP1_CAEEL RNA-binding protein rnp-1 OS=Caenorhabditis elegans OX=6239 GN=rnp-1 PE=2 SV=1
15	P92964	1.22e-16	80.9	264	0.125	0.170	SRS31_ARATH Serine/arginine-rich splicing factor RS31 OS=Arabidopsis thaliana OX=3702 GN=RS31 PE=1 SV=2
16	P92965	9.97e-16	79.7	350	0.136	0.140	RS40_ARATH Serine/arginine-rich splicing factor RS40 OS=Arabidopsis thaliana OX=3702 GN=RS40 PE=1 SV=2
17	Q5PPI1	2.07e-15	76.6	221	0.153	0.249	SRSF9_RAT Serine/arginine-rich splicing factor 9 OS=Rattus norvegicus OX=10116 GN=Srsf9 PE=1 SV=1
18	P04147	5.44e-15	78.2	577	0.134	0.083	PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAB1 PE=1 SV=4
19	P92966	9.23e-15	76.6	356	0.136	0.138	SRS41_ARATH Serine/arginine-rich splicing factor RS41 OS=Arabidopsis thaliana OX=3702 GN=RS41 PE=1 SV=2
20	Q586R7	4.12e-14	75.5	441	0.162	0.132	Q586R7_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.225 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04847 Calcipressin	2.3	19.4	Calcipressin
2	PF03880 DbpA	25	16.3	DbpA RNA binding domain
3	PF08675 RNA_bind	1.4e+02	13.9	RNA binding domain
4	PF00076 RRM_1	1.6e-31	119.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF13893 RRM_5	0.00032	31.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF16367 RRM_7	0.016	26.7	RNA recognition motif
7	PF16842 RRM_occluded	0.024	25.8	Occluded RNA-recognition motif
8	PF00098 zf-CCHC	0.00037	31.6	Zinc knuckle
9	PF13696 zf-CCHC_2	49	15.2	Zinc knuckle
10	PF13917 zf-CCHC_3	5.9	18.2	Zinc knuckle
11	PF14787 zf-CCHC_5	1.3e+02	13.6	GAG-polyprotein viral zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000007286

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000005561	0.625	Polypyrimidine tract binding protein 2
2	9555.ENSPANP00000006490	0.580	Eukaryotic translation initiation factor 4E family member 2
3	9555.ENSPANP00000008716	0.580	annotation not available
4	9555.ENSPANP00000013557	0.548	Ribonuclease P/MRP 40kDa subunit
5	9555.ENSPANP00000017245	0.545	Endothelial PAS domain protein 1
6	9555.ENSPANP00000019661	0.525	Period circadian clock 1
7	9555.ENSPANP00000010261	0.524	HAUS augmin-like complex, subunit 2
8	9555.ENSPANP00000010706	0.521	annotation not available
9	9555.ENSPANP00000018980	0.513	Polypyrimidine tract binding protein 3
10	9555.ENSPANP00000014549	0.511	RNA binding motif protein 38
11	9555.ENSPANP00000016838	0.506	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	1.000	mRNA binding
GO:0036002	0.927	pre-mRNA binding
GO:0003730	0.508	mRNA 3'-UTR binding
GO:0097157	0.360	pre-mRNA intronic binding
GO:0035198	0.342	miRNA binding
GO:0030332	0.333	cyclin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0010468	0.988	regulation of gene expression
GO:0009987	0.975	cellular process
GO:0051171	0.941	regulation of nitrogen compound metabolic process
GO:0031323	0.940	regulation of cellular metabolic process
GO:0080090	0.916	regulation of primary metabolic process
GO:0034248	0.899	regulation of amide metabolic process
GO:0010608	0.888	post-transcriptional regulation of gene expression
GO:0006417	0.881	regulation of translation
GO:0048518	0.874	positive regulation of biological process
GO:0050896	0.851	response to stimulus
GO:0071704	0.688	organic substance metabolic process
GO:0044237	0.672	cellular metabolic process
GO:0006807	0.669	nitrogen compound metabolic process
GO:0043170	0.635	macromolecule metabolic process
GO:0044238	0.622	primary metabolic process
GO:0034641	0.538	cellular nitrogen compound metabolic process
GO:0006139	0.446	nucleobase-containing compound metabolic process
GO:0016070	0.442	RNA metabolic process
GO:0051252	0.435	regulation of RNA metabolic process
GO:0010467	0.401	gene expression
GO:0006396	0.347	RNA processing
GO:0043484	0.336	regulation of RNA splicing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.979	cytosol
GO:0043232	0.970	intracellular non-membrane-bounded organelle
GO:0032991	0.958	protein-containing complex
GO:0016604	0.534	nuclear body
GO:0005730	0.424	nucleolus
GO:0016607	0.347	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]