StarFunc result for job id Q9BQ15

User Input

>input (211 residues)
MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGN
LIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQA
PNKAVQNDSNPSASQPTTGPSAASPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRIT
RSQPNHTPAGPPGPSSNPVSNGKETRRSSKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R2Y9	0.465	0.463	1.153E-26	212	0.934	0.929	Q8R2Y9.pdb.gz	SOSB1_MOUSE SOSS complex subunit B1 OS=Mus musculus OX=10090 GN=Nabp2 PE=1 SV=1
2	AFDB:Q8BGW5	0.465	0.495	2.874E-19	198	0.531	0.566	Q8BGW5.pdb.gz	SOSB2_MOUSE SOSS complex subunit B2 OS=Mus musculus OX=10090 GN=Nabp1 PE=2 SV=1
3	AFDB:Q96AH0	0.460	0.475	2.874E-19	204	0.521	0.539	Q96AH0.pdb.gz	SOSB2_HUMAN SOSS complex subunit B2 OS=Homo sapiens OX=9606 GN=NABP1 PE=1 SV=1
4	PDB:4owwB	0.444	0.868	2.643E-17	107	0.507	1.000	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
5	PDB:4owtB	0.287	0.828	8.472E-6	72	0.336	0.986	4owtB.pdb.gz
6	PDB:7qxbP	0.357	0.306	5.933E-5	251	0.085	0.072	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
7	PDB:2i0qA	0.336	0.165	9.144E-5	461	0.057	0.026	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
8	PDB:8d0bA	0.355	0.074	1.225E-3	1116	0.071	0.013	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
9	AFDB:Q6K0P9	0.341	0.155	1.729E-3	492	0.133	0.057	Q6K0P9.pdb.gz	IFIX_HUMAN Pyrin and HIN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
10	PDB:6w6wC	0.335	0.226	2.104E-3	323	0.090	0.059	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
11	AFDB:Q65XV7	0.339	0.087	9.242E-3	951	0.180	0.040	Q65XV7.pdb.gz	RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica OX=39947 GN=RPA1C PE=1 SV=1
12	PDB:7u5cE	0.342	0.071	1.187E-2	1147	0.071	0.013	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.
13	PDB:6raw5	0.299	0.124	1.733E-2	576	0.081	0.030	6raw5.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
14	PDB:5eanA	0.223	0.050	2.038E-2	1051	0.062	0.012	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
15	PDB:5zg8A	0.355	0.186	2.038E-2	422	0.090	0.045	5zg8A.pdb.gz
16	AFDB:Q5EE38	0.288	0.162	1.808E-1	416	0.185	0.094	Q5EE38.pdb.gz	ACD_MOUSE Adrenocortical dysplasia protein OS=Mus musculus OX=10090 GN=Acd PE=1 SV=1
17	AFDB:Q6DC04	0.115	0.050	4.295E-1	588	0.147	0.053	Q6DC04.pdb.gz	CARM1_DANRE Histone-arginine methyltransferase CARM1 OS=Danio rerio OX=7955 GN=carm1 PE=2 SV=1
18	AFDB:O94868	0.097	0.040	4.785E-1	740	0.166	0.047	O94868.pdb.gz	FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens OX=9606 GN=FCHSD2 PE=1 SV=3
19	AFDB:E7FB74	0.147	0.051	5.051E-1	765	0.180	0.050	E7FB74.pdb.gz	E7FB74_DANRE Ataxin-1-like OS=Danio rerio OX=7955 GN=atxn1l PE=3 SV=2
20	AFDB:Q6FII8	0.104	0.037	5.940E-1	866	0.142	0.035	Q6FII8.pdb.gz	Q6FII8_CANGA Candida glabrata strain CBS138 chromosome M complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PWP6 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQ15	1.94e-155	430	211	1.000	1.000	SOSB1_HUMAN SOSS complex subunit B1 OS=Homo sapiens OX=9606 GN=NABP2 PE=1 SV=1
2	Q8R2Y9	4.01e-142	397	212	0.934	0.929	SOSB1_MOUSE SOSS complex subunit B1 OS=Mus musculus OX=10090 GN=Nabp2 PE=1 SV=1
3	C9JMP5	1.99e-110	314	151	0.716	1.000	C9JMP5_HUMAN Nucleic acid binding protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NABP2 PE=1 SV=8
4	C9JT95	5.46e-105	300	144	0.682	1.000	C9JT95_HUMAN Nucleic acid binding protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NABP2 PE=1 SV=1
5	Q96AH0	4.65e-75	226	204	0.564	0.583	SOSB2_HUMAN SOSS complex subunit B2 OS=Homo sapiens OX=9606 GN=NABP1 PE=1 SV=1
6	Q8BGW5	8.47e-75	226	198	0.564	0.601	SOSB2_MOUSE SOSS complex subunit B2 OS=Mus musculus OX=10090 GN=Nabp1 PE=2 SV=1
7	H7C0W4	3.49e-59	185	168	0.483	0.607	H7C0W4_HUMAN Nucleic acid binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NABP1 PE=1 SV=1
8	Q8RYC3	0.013	37.7	182	0.133	0.154	Q8RYC3_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g33845 PE=1 SV=1
9	O49453	0.045	35.8	153	0.095	0.131	Y4844_ARATH Uncharacterized protein At4g28440 OS=Arabidopsis thaliana OX=3702 GN=At4g28440 PE=1 SV=1
10	Q384B5	0.53	33.5	463	0.095	0.043	Q384B5_TRYB2 Replication protein A subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0870 PE=3 SV=1
11	Q9XIJ0	0.64	32.3	153	0.066	0.092	Q9XIJ0_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g10590 PE=1 SV=1
12	F4HVV6	0.77	33.1	2431	0.137	0.012	F4HVV6_ARATH Transcription regulator OS=Arabidopsis thaliana OX=3702 GN=NOT1 PE=1 SV=1
13	P9WJV5	0.84	33.1	944	0.066	0.015	MMPL3_MYCTU Trehalose monomycolate exporter MmpL3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mmpL3 PE=1 SV=1
14	Q9ZUC0	0.92	31.6	137	0.128	0.197	Q9ZUC0_ARATH F5O8.30 protein OS=Arabidopsis thaliana OX=3702 GN=At1g23750 PE=1 SV=1
15	D3ZWX4	1.7	32.0	705	0.062	0.018	D3ZWX4_RAT NCK interacting protein with SH3 domain OS=Rattus norvegicus OX=10116 GN=Nckipsd PE=1 SV=3
16	Q9UL51	2.2	31.6	889	0.081	0.019	HCN2_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Homo sapiens OX=9606 GN=HCN2 PE=1 SV=3
17	A0A0G3VTN5	3.7	30.8	770	0.152	0.042	LHY_PETHY Protein LATE ELONGATED HYPOCOTYL OS=Petunia hybrida OX=4102 GN=LHY PE=2 SV=1
18	Q9ESJ4	3.7	30.8	714	0.062	0.018	SPN90_MOUSE NCK-interacting protein with SH3 domain OS=Mus musculus OX=10090 GN=Nckipsd PE=1 SV=2
19	O43426	4.2	30.8	1573	0.109	0.015	SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens OX=9606 GN=SYNJ1 PE=1 SV=2
20	P25439	5.0	30.8	1638	0.147	0.019	BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster OX=7227 GN=brm PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09356 Phage_BR0599	3e+02	13.1	Phage conserved hypothetical protein BR0599
2	PF01336 tRNA_anti-codon	0.0029	28.9	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318641	0.999	Integrator complex subunit 3
2	9606.ENSP00000363360	0.999	SOSS complex subunit C
3	9606.ENSP00000403683	0.905	SOSS complex subunit B2
4	9606.ENSP00000381984	0.879	Regulation of nuclear pre-mRNA domain-containing protein 1A
5	9606.ENSP00000310260	0.873	Integrator complex subunit 6
6	9606.ENSP00000385722	0.794	Integrator complex subunit 1
7	9606.ENSP00000327889	0.776	Integrator complex subunit 5
8	9606.ENSP00000429065	0.768	Integrator complex subunit 9
9	9606.ENSP00000419665	0.763	Single-stranded DNA-binding protein, mitochondrial
10	9606.ENSP00000445001	0.728	Integrator complex subunit 11
11	9606.ENSP00000362532	0.727	Regulation of nuclear pre-mRNA domain-containing protein 1B
12	9606.ENSP00000414851	0.680	Elongator complex protein 2
13	9606.ENSP00000272771	0.676	Tomoregulin-2
14	9606.ENSP00000261191	0.660	Integrator complex subunit 13
15	9606.ENSP00000358064	0.655	Regulation of nuclear pre-mRNA domain containing 2
16	9606.ENSP00000278616	0.650	Serine-protein kinase ATM
17	9606.ENSP00000434466	0.650	Integrator complex subunit 4
18	9606.ENSP00000414237	0.649	Integrator complex subunit 2
19	9606.ENSP00000415433	0.649	Integrator complex subunit 12
20	9606.ENSP00000342755	0.648	E3 ubiquitin-protein ligase NRDP1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043047	0.996	single-stranded telomeric DNA binding
GO:0070182	0.993	DNA polymerase binding
GO:0098505	0.414	G-rich strand telomeric DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.991	cellular metabolic process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0051130	0.986	positive regulation of cellular component organization
GO:0045935	0.985	positive regulation of nucleobase-containing compound metabolic process
GO:0032204	0.985	regulation of telomere maintenance
GO:2001252	0.984	positive regulation of chromosome organization
GO:0051054	0.984	positive regulation of DNA metabolic process
GO:0090304	0.978	nucleic acid metabolic process
GO:0032206	0.954	positive regulation of telomere maintenance
GO:0050896	0.934	response to stimulus
GO:0051716	0.876	cellular response to stimulus
GO:0006281	0.840	DNA repair
GO:0048523	0.500	negative regulation of cellular process
GO:0000075	0.408	cell cycle checkpoint signaling
GO:0010212	0.390	response to ionizing radiation
GO:1901991	0.390	negative regulation of mitotic cell cycle phase transition
GO:0007093	0.390	mitotic cell cycle checkpoint signaling
GO:0006302	0.387	double-strand break repair
GO:0000724	0.371	double-strand break repair via homologous recombination
GO:1902749	0.362	regulation of cell cycle G2/M phase transition
GO:0044818	0.349	mitotic G2/M transition checkpoint

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.996	cytosol
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0032991	0.975	protein-containing complex
GO:0005694	0.920	chromosome
GO:0140513	0.872	nuclear protein-containing complex
GO:0098687	0.680	chromosomal region
GO:0000781	0.463	chromosome, telomeric region
GO:0035861	0.310	site of double-strand break

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]