StarFunc result for job id Q9BQ16

User Input

>input (436 residues)
MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNK
FRDEVEDDYFRTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHR
MKEAGVDHRQWRGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCE
GHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSR
FDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLI
SNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCW
CVDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDE
DEGDDDDGGDDHDVYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BKV0	0.694	0.694	1.822E-69	436	0.901	0.901	Q8BKV0.pdb.gz	TICN3_MOUSE Testican-3 OS=Mus musculus OX=10090 GN=Spock3 PE=2 SV=2
2	AFDB:Q62288	0.456	0.451	3.063E-44	442	0.541	0.534	Q62288.pdb.gz	TICN1_MOUSE Testican-1 OS=Mus musculus OX=10090 GN=Spock1 PE=2 SV=2
3	AFDB:Q92563	0.401	0.410	5.199E-40	424	0.456	0.469	Q92563.pdb.gz	TICN2_HUMAN Testican-2 OS=Homo sapiens OX=9606 GN=SPOCK2 PE=1 SV=1
4	AFDB:Q9VCR3	0.241	0.176	5.225E-20	629	0.291	0.202	Q9VCR3.pdb.gz	COW_DROME Proteoglycan Cow OS=Drosophila melanogaster OX=7227 GN=Cow PE=1 SV=3
5	AFDB:E7EDQ9	0.169	0.160	1.264E-7	461	0.119	0.113	E7EDQ9.pdb.gz	E7EDQ9_DANRE SPARC-related modular calcium-binding 1 OS=Danio rerio OX=7955 GN=smoc1 PE=2 SV=1
6	AFDB:Q8BLY1	0.135	0.127	2.409E-7	463	0.117	0.110	Q8BLY1.pdb.gz	SMOC1_MOUSE SPARC-related modular calcium-binding protein 1 OS=Mus musculus OX=10090 GN=Smoc1 PE=2 SV=2
7	AFDB:Q8CD91	0.144	0.141	9.849E-7	447	0.096	0.094	Q8CD91.pdb.gz	SMOC2_MOUSE SPARC-related modular calcium-binding protein 2 OS=Mus musculus OX=10090 GN=Smoc2 PE=1 SV=1
8	AFDB:P10247	0.143	0.218	6.827E-6	280	0.106	0.164	P10247.pdb.gz	HG2A_RAT H-2 class II histocompatibility antigen gamma chain OS=Rattus norvegicus OX=10116 GN=Cd74 PE=1 SV=2
9	AFDB:P04441	0.152	0.232	2.632E-5	279	0.101	0.158	P04441.pdb.gz	HG2A_MOUSE H-2 class II histocompatibility antigen gamma chain OS=Mus musculus OX=10090 GN=Cd74 PE=1 SV=3
10	AFDB:E7FET3	0.154	0.154	3.139E-5	437	0.106	0.105	E7FET3.pdb.gz
11	PDB:3b4vD	0.090	0.178	2.661E-3	213	0.048	0.099	3b4vD.pdb.gz
12	PDB:2p6aD	0.085	0.126	5.381E-3	292	0.055	0.082	2p6aD.pdb.gz	Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
13	PDB:2leoA	0.093	0.554	8.113E-3	66	0.032	0.212	2leoA.pdb.gz
14	PDB:1yu6C	0.097	0.701	9.674E-3	51	0.025	0.216	1yu6C.pdb.gz	Structure of the subtilisin Carlsberg-OMTKY3 complex reveals two different ovomucoid conformations.
15	PDB:7qe9C	0.098	0.635	2.950E-2	60	0.037	0.267	7qe9C.pdb.gz
16	PDB:7eebI	0.111	0.265	7.541E-2	174	0.023	0.057	7eebI.pdb.gz	Structure of a mammalian sperm cation channel complex.
17	PDB:1s1eA	0.119	0.273	8.480E-2	181	0.041	0.099	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
18	PDB:5aanA	0.122	0.279	9.536E-2	183	0.023	0.055	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
19	PDB:5a2hA	0.167	0.434	1.279E-1	147	0.050	0.150	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
20	PDB:4ygeF	0.113	0.638	1.356E-1	67	0.028	0.179	4ygeF.pdb.gz	Crystallographic snapshots of the EF-hand protein MCFD2 complexed with the intracellular lectin ERGIC-53 involved in glycoprotein transport.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BKV0	0.0	766	436	0.853	0.853	TICN3_MOUSE Testican-3 OS=Mus musculus OX=10090 GN=Spock3 PE=2 SV=2
2	Q9BQ16	0.0	905	436	1.000	1.000	TICN3_HUMAN Testican-3 OS=Homo sapiens OX=9606 GN=SPOCK3 PE=1 SV=2
3	Q62288	9.87e-155	447	442	0.507	0.500	TICN1_MOUSE Testican-1 OS=Mus musculus OX=10090 GN=Spock1 PE=2 SV=2
4	Q08629	1.40e-148	431	439	0.500	0.497	TICN1_HUMAN Testican-1 OS=Homo sapiens OX=9606 GN=SPOCK1 PE=1 SV=1
5	Q92563	9.63e-128	377	424	0.427	0.439	TICN2_HUMAN Testican-2 OS=Homo sapiens OX=9606 GN=SPOCK2 PE=1 SV=1
6	Q9ER58	1.01e-125	372	423	0.413	0.426	TICN2_MOUSE Testican-2 OS=Mus musculus OX=10090 GN=Spock2 PE=1 SV=1
7	Q9VCR3	5.22e-31	127	629	0.156	0.108	COW_DROME Proteoglycan Cow OS=Drosophila melanogaster OX=7227 GN=Cow PE=1 SV=3
8	Q86MK1	3.38e-12	70.5	523	0.186	0.155	Q86MK1_DROME CG2264A OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
9	A4UZB1	1.43e-10	65.5	520	0.133	0.112	A4UZB1_DROME Magu, isoform F OS=Drosophila melanogaster OX=7227 GN=magu PE=4 SV=1
10	Q6IQH0	5.36e-10	62.4	291	0.158	0.237	Q6IQH0_DANRE SPARC OS=Danio rerio OX=7955 GN=hm:zeh0062 PE=1 SV=1
11	Q14515	6.46e-10	63.5	664	0.156	0.102	SPRL1_HUMAN SPARC-like protein 1 OS=Homo sapiens OX=9606 GN=SPARCL1 PE=1 SV=2
12	F1RGY5	6.62e-10	63.9	1309	0.060	0.020	F1RGY5_PIG Nidogen 1 OS=Sus scrofa OX=9823 GN=NID1 PE=1 SV=4
13	A0A193GP06	1.21e-09	63.2	2733	0.067	0.011	A0A193GP06_DANRE Thyroglobulin OS=Danio rerio OX=7955 GN=Tg PE=1 SV=1
14	P24054	1.33e-09	62.4	634	0.122	0.084	SPRL1_RAT SPARC-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sparcl1 PE=1 SV=1
15	P04233	2.55e-09	60.5	296	0.073	0.108	HG2A_HUMAN HLA class II histocompatibility antigen gamma chain OS=Homo sapiens OX=9606 GN=CD74 PE=1 SV=3
16	P14543	2.83e-09	62.0	1247	0.057	0.020	NID1_HUMAN Nidogen-1 OS=Homo sapiens OX=9606 GN=NID1 PE=1 SV=3
17	P10493	2.93e-09	61.6	1245	0.071	0.025	NID1_MOUSE Nidogen-1 OS=Mus musculus OX=10090 GN=Nid1 PE=1 SV=2
18	P70663	5.06e-09	60.8	650	0.122	0.082	SPRL1_MOUSE SPARC-like protein 1 OS=Mus musculus OX=10090 GN=Sparcl1 PE=1 SV=3
19	P10247	8.38e-09	58.5	280	0.080	0.125	HG2A_RAT H-2 class II histocompatibility antigen gamma chain OS=Rattus norvegicus OX=10116 GN=Cd74 PE=1 SV=2
20	P04441	1.78e-08	57.8	279	0.071	0.111	HG2A_MOUSE H-2 class II histocompatibility antigen gamma chain OS=Mus musculus OX=10090 GN=Cd74 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00050 Kazal_1	2.2	19.7	Kazal-type serine protease inhibitor domain
2	PF07648 Kazal_2	2.3e-09	48.6	Kazal-type serine protease inhibitor domain
3	PF10591 SPARC_Ca_bdg	2.8e-32	122.8	Secreted protein acidic and rich in cysteine Ca binding region
4	PF00086 Thyroglobulin_1	1.6e-14	64.6	Thyroglobulin type-1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349677

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308208	0.969	Matrix metalloproteinase-14
2	9606.ENSP00000219070	0.937	72 kDa type IV collagenase
3	9606.ENSP00000262768	0.903	Metalloproteinase inhibitor 2
4	9606.ENSP00000231061	0.851	SPARC
5	9606.ENSP00000420180	0.784	Coiled-coil domain-containing protein 14
6	9606.ENSP00000355110	0.762	SPARC-related modular calcium-binding protein 1
7	9606.ENSP00000286614	0.748	Matrix metalloproteinase-16
8	9606.ENSP00000346537	0.746	SPARC-related modular calcium-binding protein 2
9	9606.ENSP00000350937	0.737	Testin
10	9606.ENSP00000352248	0.698	Annexin A10
11	9606.ENSP00000262013	0.665	C-Jun-amino-terminal kinase-interacting protein 4
12	9606.ENSP00000334051	0.652	Guanine nucleotide-binding protein G(olf) subunit alpha
13	9606.ENSP00000295491	0.630	Mitochondrial ribosomal protein S18C
14	9606.ENSP00000414856	0.623	SPARC-like protein 1
15	9606.ENSP00000404092	0.616	Structural maintenance of chromosomes protein 6
16	9606.ENSP00000384719	0.604	Visinin-like protein 1
17	9606.ENSP00000281047	0.573	Mesogenin-1
18	9606.ENSP00000265807	0.563	SH2 domain-containing protein 4A
19	9606.ENSP00000345192	0.544	Noelin-3
20	9606.ENSP00000265969	0.524	Potassium voltage-gated channel subfamily C member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0030234	0.995	enzyme regulator activity
GO:0140678	0.991	molecular function inhibitor activity
GO:0004866	0.977	endopeptidase inhibitor activity
GO:0097367	0.966	carbohydrate derivative binding
GO:0005539	0.925	glycosaminoglycan binding
GO:0008191	0.791	metalloendopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0009987	0.936	cellular process
GO:0019222	0.927	regulation of metabolic process
GO:0048519	0.926	negative regulation of biological process
GO:0060255	0.861	regulation of macromolecule metabolic process
GO:0080090	0.846	regulation of primary metabolic process
GO:0051171	0.843	regulation of nitrogen compound metabolic process
GO:0043086	0.813	negative regulation of catalytic activity
GO:0051346	0.802	negative regulation of hydrolase activity
GO:0040012	0.799	regulation of locomotion
GO:0009892	0.782	negative regulation of metabolic process
GO:0052547	0.773	regulation of peptidase activity
GO:0045861	0.698	negative regulation of proteolysis
GO:0010466	0.678	negative regulation of peptidase activity
GO:0071704	0.672	organic substance metabolic process
GO:0044238	0.667	primary metabolic process
GO:0052548	0.607	regulation of endopeptidase activity
GO:0006807	0.564	nitrogen compound metabolic process
GO:0044237	0.459	cellular metabolic process
GO:0010951	0.447	negative regulation of endopeptidase activity
GO:0043170	0.411	macromolecule metabolic process
GO:2000145	0.382	regulation of cell motility
GO:1901564	0.327	organonitrogen compound metabolic process
GO:0019538	0.300	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0005576	0.996	extracellular region
GO:0005615	0.862	extracellular space
GO:0030312	0.839	external encapsulating structure
GO:0005622	0.742	intracellular anatomical structure
GO:0016020	0.722	membrane
GO:0005737	0.703	cytoplasm
GO:0031012	0.647	extracellular matrix
GO:0043226	0.601	organelle
GO:0043229	0.497	intracellular organelle
GO:0030054	0.372	cell junction
GO:0033268	0.368	node of Ranvier
GO:0016528	0.367	sarcoplasm
GO:0031594	0.364	neuromuscular junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]