StarFunc result for job id Q9BQ51

User Input

>input (273 residues)
MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQ
KVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVK
ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVL
RLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATV
IALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQ51	1.000	1.000	1.172E-50	273	1.000	1.000	Q9BQ51.pdb.gz	PD1L2_HUMAN Programmed cell death 1 ligand 2 OS=Homo sapiens OX=9606 GN=PDCD1LG2 PE=1 SV=2
2	AFDB:Q9WUL5	0.779	0.857	2.878E-33	247	0.612	0.676	Q9WUL5.pdb.gz	PD1L2_MOUSE Programmed cell death 1 ligand 2 OS=Mus musculus OX=10090 GN=Pdcd1lg2 PE=1 SV=1
3	AFDB:D4AE25	0.635	0.600	2.387E-22	290	0.363	0.341	D4AE25.pdb.gz	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
4	AFDB:Q4QTK1	0.650	0.623	4.829E-22	287	0.344	0.328	Q4QTK1.pdb.gz	Q4QTK1_PIG CD274 molecule OS=Sus scrofa OX=9823 GN=CD274 PE=2 SV=1
5	AFDB:Q9EP73	0.632	0.597	1.352E-21	290	0.363	0.341	Q9EP73.pdb.gz	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
6	AFDB:Q9NZQ7	0.622	0.592	3.217E-21	290	0.352	0.331	Q9NZQ7.pdb.gz	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
7	AFDB:Q8WVV5	0.652	0.356	6.514E-17	523	0.220	0.115	Q8WVV5.pdb.gz	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2
8	AFDB:Q62556	0.595	0.325	1.005E-16	524	0.256	0.134	Q62556.pdb.gz	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
9	AFDB:Q8VE98	0.619	0.540	1.061E-16	316	0.223	0.193	Q8VE98.pdb.gz	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
10	AFDB:O00478	0.604	0.300	1.824E-16	584	0.223	0.104	O00478.pdb.gz	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
11	PDB:5c7kF	0.286	0.354	7.743E-10	212	0.110	0.142	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
12	PDB:3c2aL	0.308	0.380	2.288E-9	216	0.154	0.194	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
13	PDB:1jnhA	0.301	0.386	3.001E-9	208	0.158	0.207	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
14	PDB:3o3uN	0.465	0.238	3.934E-9	580	0.154	0.072	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
15	PDB:1a8jL	0.303	0.368	4.153E-9	216	0.150	0.190	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
16	PDB:7qpdT	0.473	0.379	4.385E-9	348	0.121	0.095	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.
17	PDB:1aqkL	0.307	0.380	4.629E-9	216	0.143	0.181	1aqkL.pdb.gz
18	PDB:4xnyL	0.276	0.342	5.749E-9	211	0.114	0.147	4xnyL.pdb.gz
19	PDB:1gafL	0.287	0.351	7.957E-9	214	0.114	0.145	1gafL.pdb.gz	The immunological evolution of catalysis.
20	PDB:1q0xL	0.312	0.391	8.400E-9	212	0.147	0.189	1q0xL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQ51	0.0	565	273	1.000	1.000	PD1L2_HUMAN Programmed cell death 1 ligand 2 OS=Homo sapiens OX=9606 GN=PDCD1LG2 PE=1 SV=2
2	Q9WUL5	2.84e-120	345	247	0.608	0.672	PD1L2_MOUSE Programmed cell death 1 ligand 2 OS=Mus musculus OX=10090 GN=Pdcd1lg2 PE=1 SV=1
3	Q9NZQ7	2.80e-43	150	290	0.348	0.328	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
4	D4AE25	7.64e-43	149	290	0.385	0.362	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
5	Q9EP73	1.89e-42	148	290	0.370	0.348	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
6	Q4QTK1	1.10e-39	141	287	0.311	0.296	Q4QTK1_PIG CD274 molecule OS=Sus scrofa OX=9823 GN=CD274 PE=2 SV=1
7	Q62556	1.19e-14	75.5	524	0.260	0.135	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
8	P78410	3.11e-13	70.9	334	0.267	0.219	BT3A2_HUMAN Butyrophilin subfamily 3 member A2 OS=Homo sapiens OX=9606 GN=BTN3A2 PE=1 SV=2
9	Q5ZPR3	5.64e-13	70.9	534	0.249	0.127	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
10	O00478	1.97e-12	68.9	584	0.260	0.122	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
11	Q13410	3.45e-12	68.2	526	0.234	0.122	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
12	A2CG22	2.37e-10	62.8	539	0.176	0.089	A2CG22_MOUSE Butyrophilin-like 6 OS=Mus musculus OX=10090 GN=Btnl6 PE=1 SV=1
13	O70355	1.91e-09	60.1	454	0.154	0.093	BTNL2_MOUSE Butyrophilin-like protein 2 OS=Mus musculus OX=10090 GN=Btnl2 PE=1 SV=2
14	Q8VE98	7.35e-09	57.8	316	0.190	0.165	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
15	O00481	1.33e-08	57.4	513	0.187	0.099	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
16	A0N0L8	7.03e-07	52.0	302	0.194	0.175	A0N0L8_HUMAN Inducible T-cell co-stimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=2 SV=1
17	O75144	7.03e-07	52.0	302	0.194	0.175	ICOSL_HUMAN ICOS ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=2
18	K4DIA0	3.92e-06	50.1	473	0.194	0.112	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
19	A4QPC6	4.00e-06	50.1	514	0.198	0.105	BT2A2_MOUSE Butyrophilin subfamily 2 member A2 OS=Mus musculus OX=10090 GN=Btn2a2 PE=1 SV=1
20	Q921X1	1.02e-05	47.4	179	0.128	0.196	Q921X1_MOUSE Btn1a1 protein OS=Mus musculus OX=10090 GN=Btn1a1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	0.037	25.4	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	2.5e-05	35.6	Immunoglobulin I-set domain
3	PF00047 ig	0.04	25.4	Immunoglobulin domain
4	PF13895 Ig_2	3.5e-10	51.4	Immunoglobulin domain
5	PF13927 Ig_3	3.9e-11	54.7	Immunoglobulin domain
6	PF07686 V-set	2.8	19.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380855

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335062	0.999	Programmed cell death protein 1
2	9606.ENSP00000308219	0.984	RGM domain family member B
3	9606.ENSP00000011653	0.977	T-cell surface glycoprotein CD4
4	9606.ENSP00000370989	0.977	Programmed cell death 1 ligand 1
5	9606.ENSP00000264246	0.966	T-lymphocyte activation antigen CD80
6	9606.ENSP00000354782	0.950	T-cell surface glycoprotein CD3 zeta chain
7	9606.ENSP00000354566	0.930	T-cell surface glycoprotein CD3 epsilon chain
8	9606.ENSP00000339398	0.928	Major histocompatibility complex, class II, DQ alpha 1
9	9606.ENSP00000378786	0.926	HLA class II histocompatibility antigen, DR alpha chain
10	9606.ENSP00000364076	0.922	HLA class II histocompatibility antigen, DQ alpha 2 chain
11	9606.ENSP00000353099	0.920	HLA class II histocompatibility antigen, DRB1-15 beta chain
12	9606.ENSP00000393566	0.919	HLA class II histocompatibility antigen, DP alpha 1 chain
13	9606.ENSP00000390431	0.918	Major histocompatibility complex, class II, DQ beta 2
14	9606.ENSP00000300692	0.917	T-cell surface glycoprotein CD3 delta chain
15	9606.ENSP00000364080	0.917	HLA class II histocompatibility antigen, DQ beta 1 chain
16	9606.ENSP00000431445	0.915	T-cell surface glycoprotein CD3 gamma chain
17	9606.ENSP00000408146	0.908	HLA class II histocompatibility antigen, DP beta 1 chain
18	9606.ENSP00000364114	0.907	HLA class II histocompatibility antigen, DR beta 5 chain
19	9606.ENSP00000303939	0.898	Cytotoxic T-lymphocyte protein 4
20	9606.ENSP00000332049	0.845	T-lymphocyte activation antigen CD86

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.300	molecular transducer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.996	regulation of metabolic process
GO:0070663	0.995	regulation of leukocyte proliferation
GO:1903037	0.995	regulation of leukocyte cell-cell adhesion
GO:0050863	0.995	regulation of T cell activation
GO:0042129	0.994	regulation of T cell proliferation
GO:0048523	0.993	negative regulation of cellular process
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0001817	0.936	regulation of cytokine production
GO:0002683	0.924	negative regulation of immune system process
GO:0048518	0.887	positive regulation of biological process
GO:0008285	0.879	negative regulation of cell population proliferation
GO:0051241	0.872	negative regulation of multicellular organismal process
GO:0007162	0.823	negative regulation of cell adhesion
GO:0048522	0.816	positive regulation of cellular process
GO:0002695	0.816	negative regulation of leukocyte activation
GO:0051250	0.804	negative regulation of lymphocyte activation
GO:1903038	0.788	negative regulation of leukocyte cell-cell adhesion
GO:0050868	0.746	negative regulation of T cell activation
GO:0009987	0.730	cellular process
GO:0042130	0.728	negative regulation of T cell proliferation
GO:0032649	0.719	regulation of type II interferon production
GO:0010629	0.703	negative regulation of gene expression
GO:0032653	0.691	regulation of interleukin-10 production
GO:0050896	0.666	response to stimulus
GO:0001818	0.656	negative regulation of cytokine production
GO:0046006	0.509	regulation of activated T cell proliferation
GO:0032689	0.508	negative regulation of type II interferon production
GO:0051240	0.461	positive regulation of multicellular organismal process
GO:0002684	0.452	positive regulation of immune system process
GO:0009893	0.450	positive regulation of metabolic process
GO:0002376	0.404	immune system process
GO:0010604	0.403	positive regulation of macromolecule metabolic process
GO:1903039	0.378	positive regulation of leukocyte cell-cell adhesion
GO:0051251	0.378	positive regulation of lymphocyte activation
GO:0048583	0.322	regulation of response to stimulus
GO:0050870	0.322	positive regulation of T cell activation
GO:0008284	0.304	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.800	intracellular anatomical structure
GO:0043226	0.784	organelle
GO:0043231	0.768	intracellular membrane-bounded organelle
GO:0005737	0.434	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]