StarFunc result for job id Q9BQ67

User Input

>input (446 residues)
MAARKGRRRTCETGEPMEAESGDTSSEGPAQVYLPGRGPPLREGEELVMDEEAYVLYHRA
QTGAPCLSFDIVRDHLGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMHNLHGTKPPPSE
GSDEEEEEEDEEDEEERKPQLELAMVPHYGGINRVRVSWLGEEPVAGVWSEKGQVEVFAL
RRLLQVVEEPQALAAFLRDEQAQMKPIFSFAGHMGEGFALDWSPRVTGRLLTGDCQKNIH
LWTPTDGGSWHVDQRPFVGHTRSVEDLQWSPTENTVFASCSADASIRIWDIRAAPSKACM
LTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSPVATFKQHVAPVTSVE
WHPQDSGVFAASGADHQITQWDLAVERDPEAGDVEADPGLADLPQQLLFVHQGETELKEL
HWHPQCPGLLVSTALSGFTIFRTISV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQ67	1.000	1.000	1.072E-89	446	1.000	1.000	Q9BQ67.pdb.gz	GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1
2	AFDB:Q9ZUN8	0.837	0.797	2.309E-46	469	0.424	0.403	Q9ZUN8.pdb.gz	HTD1_ARATH Protein HEAT STRESS TOLERANT DWD 1 OS=Arabidopsis thaliana OX=3702 GN=HTD1 PE=1 SV=1
3	AFDB:Q9P783	0.845	0.787	2.575E-44	480	0.390	0.362	Q9P783.pdb.gz	RRB1_SCHPO Ribosome assembly protein rrb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrb1 PE=1 SV=1
4	AFDB:Q04225	0.849	0.745	2.463E-40	511	0.348	0.303	Q04225.pdb.gz	RRB1_YEAST Ribosome assembly protein RRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRB1 PE=1 SV=1
5	AFDB:Q386K4	0.811	0.634	2.002E-39	576	0.318	0.247	Q386K4.pdb.gz	Q386K4_TRYB2 Histone-binding protein RBBP4 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0570 PE=4 SV=1
6	PDB:3cfvB	0.657	0.741	3.002E-25	393	0.213	0.242	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
7	AFDB:O22469	0.672	0.705	8.036E-25	424	0.213	0.224	O22469.pdb.gz	MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2
8	AFDB:Q7ZTY4	0.677	0.707	1.160E-24	426	0.206	0.216	Q7ZTY4.pdb.gz	RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio OX=7955 GN=rbbp7 PE=2 SV=1
9	PDB:6zrdA	0.680	0.735	1.445E-24	411	0.213	0.231	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
10	AFDB:O22467	0.679	0.713	1.507E-24	424	0.204	0.215	O22467.pdb.gz	MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana OX=3702 GN=MSI1 PE=1 SV=1
11	AFDB:P90917	0.687	0.741	2.681E-24	412	0.204	0.221	P90917.pdb.gz	RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans OX=6239 GN=rba-1 PE=1 SV=1
12	AFDB:Q24572	0.682	0.707	2.681E-24	430	0.206	0.214	Q24572.pdb.gz	CAF1_DROME Chromatin assembly factor 1 p55 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-55 PE=1 SV=1
13	PDB:6s29C	0.664	0.747	4.819E-24	394	0.202	0.228	6s29C.pdb.gz
14	PDB:2ybaB	0.672	0.779	1.448E-23	382	0.215	0.251	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
15	PDB:3gfcA	0.648	0.844	2.444E-23	339	0.200	0.263	3gfcA.pdb.gz
16	PDB:4pswB	0.653	0.788	2.714E-23	366	0.175	0.213	4pswB.pdb.gz	Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
17	PDB:3w15A	0.582	0.754	1.191E-16	336	0.137	0.182	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
18	PDB:7ktrB	0.522	0.441	3.584E-15	534	0.166	0.139	7ktrB.pdb.gz	Structure of the human SAGA coactivator complex.
19	PDB:3jcmB	0.555	0.576	8.285E-15	429	0.126	0.131	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
20	PDB:5a2qg	0.544	0.753	1.553E-14	314	0.132	0.188	5a2qg.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQ67	0.0	916	446	1.000	1.000	GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1
2	M0QX71	1.43e-167	471	228	0.511	1.000	M0QX71_HUMAN Glutamate rich WD repeat containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1
3	Q9ZUN8	1.82e-104	320	469	0.419	0.399	HTD1_ARATH Protein HEAT STRESS TOLERANT DWD 1 OS=Arabidopsis thaliana OX=3702 GN=HTD1 PE=1 SV=1
4	Q9P783	5.37e-102	314	480	0.388	0.360	RRB1_SCHPO Ribosome assembly protein rrb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrb1 PE=1 SV=1
5	Q04225	9.84e-75	244	511	0.352	0.307	RRB1_YEAST Ribosome assembly protein RRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRB1 PE=1 SV=1
6	Q386K4	1.19e-68	230	576	0.321	0.248	Q386K4_TRYB2 Histone-binding protein RBBP4 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0570 PE=4 SV=1
7	Q09028	1.49e-29	121	425	0.164	0.172	RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3
8	Q60972	1.49e-29	121	425	0.164	0.172	RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus musculus OX=10090 GN=Rbbp4 PE=1 SV=5
9	Q7ZTY4	3.16e-29	120	426	0.164	0.171	RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio OX=7955 GN=rbbp7 PE=2 SV=1
10	A0A8I6AQI0	3.43e-29	121	489	0.164	0.149	A0A8I6AQI0_RAT RB binding protein 4, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Rbbp4 PE=1 SV=1
11	Q24572	7.35e-29	119	430	0.164	0.170	CAF1_DROME Chromatin assembly factor 1 p55 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-55 PE=1 SV=1
12	Q16576	4.04e-28	117	425	0.166	0.174	RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
13	Q6FHQ0	4.04e-28	117	425	0.166	0.174	Q6FHQ0_HUMAN RBBP7 protein (Fragment) OS=Homo sapiens OX=9606 GN=RBBP7 PE=2 SV=1
14	Q71UF4	4.04e-28	117	425	0.166	0.174	RBBP7_RAT Histone-binding protein RBBP7 OS=Rattus norvegicus OX=10116 GN=Rbbp7 PE=2 SV=1
15	E9PC52	4.17e-28	117	416	0.166	0.178	E9PC52_HUMAN RB binding protein 7, chromatin remodeling factor OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1
16	Q60973	4.41e-28	117	425	0.166	0.174	RBBP7_MOUSE Histone-binding protein RBBP7 OS=Mus musculus OX=10090 GN=Rbbp7 PE=1 SV=1
17	Q6P3H7	4.95e-28	117	424	0.168	0.177	RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio OX=7955 GN=rbbp4 PE=2 SV=3
18	Q54SD4	1.32e-27	115	423	0.204	0.215	RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum OX=44689 GN=rbbD PE=3 SV=1
19	P90916	1.77e-26	112	417	0.177	0.189	LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans OX=6239 GN=lin-53 PE=1 SV=2
20	P90917	5.95e-24	105	412	0.150	0.163	RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans OX=6239 GN=rba-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.0049	28.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF12265 CAF1C_H4-bd	4.2e-08	44.7	Histone-binding protein RBBP4 or subunit C of CAF1 complex
3	PF00400 WD40	1.3e-16	71.9	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253237

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000423067	0.995	WD repeat-containing protein 36
2	9606.ENSP00000455106	0.992	Ribosome biogenesis protein BOP1
3	9606.ENSP00000317992	0.990	Nucleolar complex protein 2 homolog
4	9606.ENSP00000346001	0.988	60S ribosomal protein L3
5	9606.ENSP00000263239	0.974	ATP-dependent RNA helicase DDX18
6	9606.ENSP00000354040	0.971	Nucleolar GTP-binding protein 1
7	9606.ENSP00000258772	0.970	Probable ATP-dependent RNA helicase DDX56
8	9606.ENSP00000322396	0.963	Ribosome biogenesis regulatory protein homolog
9	9606.ENSP00000395772	0.963	Guanine nucleotide-binding protein-like 3
10	9606.ENSP00000371101	0.959	Nucleolar protein 10
11	9606.ENSP00000338573	0.957	Guanine nucleotide-binding protein-like 3-like protein
12	9606.ENSP00000355541	0.957	HEAT repeat-containing protein 1
13	9606.ENSP00000367029	0.956	DNA-directed RNA polymerase I subunit RPA49
14	9606.ENSP00000225298	0.952	U3 small nucleolar RNA-associated protein 18 homolog
15	9606.ENSP00000407323	0.946	Probable rRNA-processing protein EBP2
16	9606.ENSP00000308179	0.945	WD repeat-containing protein 3
17	9606.ENSP00000230340	0.942	Bystin
18	9606.ENSP00000402338	0.940	Ribosome production factor 2 homolog
19	9606.ENSP00000371858	0.939	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
20	9606.ENSP00000368887	0.938	P21-activated protein kinase-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	0.997	histone binding
GO:0003677	0.995	DNA binding
GO:0003682	0.992	chromatin binding
GO:0003688	0.991	DNA replication origin binding
GO:0003723	0.943	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0044237	0.971	cellular metabolic process
GO:0006807	0.902	nitrogen compound metabolic process
GO:0071840	0.893	cellular component organization or biogenesis
GO:0043170	0.839	macromolecule metabolic process
GO:0034641	0.813	cellular nitrogen compound metabolic process
GO:0016043	0.793	cellular component organization
GO:0044260	0.781	cellular macromolecule metabolic process
GO:1901360	0.780	organic cyclic compound metabolic process
GO:0006725	0.768	cellular aromatic compound metabolic process
GO:0046483	0.767	heterocycle metabolic process
GO:0006139	0.758	nucleobase-containing compound metabolic process
GO:0044085	0.744	cellular component biogenesis
GO:0090304	0.739	nucleic acid metabolic process
GO:0065007	0.721	biological regulation
GO:0050794	0.598	regulation of cellular process
GO:0022411	0.597	cellular component disassembly
GO:0006260	0.576	DNA replication
GO:0065003	0.538	protein-containing complex assembly
GO:0065004	0.498	protein-DNA complex assembly
GO:0032984	0.490	protein-containing complex disassembly
GO:0006338	0.463	chromatin remodeling
GO:0034728	0.416	nucleosome organization
GO:0006334	0.395	nucleosome assembly
GO:0019222	0.378	regulation of metabolic process
GO:0060255	0.363	regulation of macromolecule metabolic process
GO:0080090	0.358	regulation of primary metabolic process
GO:0031323	0.356	regulation of cellular metabolic process
GO:0051171	0.354	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0032991	0.996	protein-containing complex
GO:0005730	0.969	nucleolus
GO:0005829	0.966	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]