StarFunc result for job id Q9BQ69

User Input

>input (325 residues)
MSLQSRLSGRLAQLRAAGQLLVPPRPRPGHLAGATRTRSSTCGPPAFLGVFGRRARTSAG
VGAWGAAAVGRTAGVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFV
RLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEVDAIVNAANSSLLGG
GGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGYRLPAKYVIHTVGPIAYGEPSASQA
AELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDR
LIICVFLEKDEDIYRSRLPHYFPVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQ69	1.000	1.000	2.328E-62	325	1.000	1.000	Q9BQ69.pdb.gz	MACD1_HUMAN ADP-ribose glycohydrolase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2
2	AFDB:Q922B1	0.768	0.773	1.530E-52	323	0.809	0.814	Q922B1.pdb.gz	MACD1_MOUSE ADP-ribose glycohydrolase MACROD1 OS=Mus musculus OX=10090 GN=Macrod1 PE=1 SV=2
3	AFDB:A1Z1Q3	0.659	0.505	1.447E-31	425	0.394	0.301	A1Z1Q3.pdb.gz	MACD2_HUMAN ADP-ribose glycohydrolase MACROD2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=2
4	AFDB:Q3UYG8	0.660	0.453	2.618E-31	475	0.409	0.280	Q3UYG8.pdb.gz	MACD2_MOUSE ADP-ribose glycohydrolase MACROD2 OS=Mus musculus OX=10090 GN=Macrod2 PE=1 SV=1
5	AFDB:A0A2R8YFN3	0.664	0.478	6.376E-31	453	0.397	0.285	A0A2R8YFN3.pdb.gz	A0A2R8YFN3_HUMAN Mono-ADP ribosylhydrolase 2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=1
6	PDB:6y4zA	0.649	0.949	2.066E-30	221	0.391	0.575	6y4zA.pdb.gz
7	AFDB:Q57ZT5	0.547	0.667	1.961E-20	265	0.268	0.328	Q57ZT5.pdb.gz	Q57ZT5_TRYB2 Macro domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.980 PE=4 SV=1
8	AFDB:Q94JV1	0.567	0.332	1.761E-19	562	0.258	0.149	Q94JV1.pdb.gz	Q94JV1_ARATH Appr-1-p processing enzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At1g69340 PE=1 SV=1
9	AFDB:Q9DBL2	0.569	0.375	1.983E-19	498	0.228	0.149	Q9DBL2.pdb.gz	GDAP2_MOUSE Ganglioside-induced differentiation-associated protein 2 OS=Mus musculus OX=10090 GN=Gdap2 PE=1 SV=1
10	AFDB:P67343	0.541	0.653	9.843E-19	266	0.243	0.297	P67343.pdb.gz	ADPRH_STAAM Protein-ADP-ribose hydrolase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0325 PE=1 SV=1
11	AFDB:P0DN70	0.523	0.625	1.176E-18	270	0.249	0.300	P0DN70.pdb.gz	ADPRH_STRPG Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) OX=160491 GN=SpyM50868 PE=1 SV=1
12	PDB:5cb5R	0.481	0.891	2.516E-18	173	0.240	0.451	5cb5R.pdb.gz	Structural insights into the mechanism of Escherichia coli YmdB: A 2'-O-acetyl-ADP-ribose deacetylase
13	PDB:6fx7A	0.437	0.717	9.156E-14	194	0.163	0.273	6fx7A.pdb.gz	Crystal structure of in vitro evolved Af1521
14	PDB:6lfqA	0.331	0.571	3.702E-5	169	0.086	0.166	6lfqA.pdb.gz
15	PDB:2lgrA	0.330	0.649	5.285E-5	152	0.086	0.184	2lgrA.pdb.gz
16	PDB:1gytA	0.418	0.278	1.538E-4	503	0.043	0.028	1gytA.pdb.gz	X-Ray Structure of Aminopeptidase a from Escherichia Coli and a Model for the Nucleoprotein Complex in Xer Site-Specific Recombination
17	PDB:4ksiA	0.345	0.234	2.623E-4	517	0.080	0.050	4ksiA.pdb.gz	Structure of tomato wound-induced leucine aminopeptidase sheds light on substrate specificity.
18	PDB:7epuB	0.305	0.152	4.802E-3	748	0.089	0.039	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
19	PDB:2ewbA	0.279	0.196	6.856E-3	486	0.058	0.039	2ewbA.pdb.gz	Metal Ion Substitution in the Catalytic Site Greatly Affects the Binding of Sulfhydryl-Containing Compounds to Leucyl Aminopeptidase.
20	PDB:5tifA	0.218	0.325	2.848E-2	182	0.083	0.148	5tifA.pdb.gz	Computational Redesign of Acyl-ACP Thioesterase with Improved Selectivity toward Medium-Chain-Length Fatty Acids.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q922B1	0.0	528	323	0.849	0.854	MACD1_MOUSE ADP-ribose glycohydrolase MACROD1 OS=Mus musculus OX=10090 GN=Macrod1 PE=1 SV=2
2	Q9BQ69	0.0	664	325	1.000	1.000	MACD1_HUMAN ADP-ribose glycohydrolase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2
3	Q3UYG8	6.03e-84	263	475	0.409	0.280	MACD2_MOUSE ADP-ribose glycohydrolase MACROD2 OS=Mus musculus OX=10090 GN=Macrod2 PE=1 SV=1
4	A1Z1Q3	1.39e-81	255	425	0.394	0.301	MACD2_HUMAN ADP-ribose glycohydrolase MACROD2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=2
5	A0A2R8YFN3	3.36e-81	255	453	0.394	0.283	A0A2R8YFN3_HUMAN Mono-ADP ribosylhydrolase 2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=1
6	Q57ZT5	7.27e-47	160	265	0.268	0.328	Q57ZT5_TRYB2 Macro domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.980 PE=4 SV=1
7	P0A8D6	1.36e-41	144	177	0.255	0.469	YMDB_ECOLI O-acetyl-ADP-ribose deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=ymdB PE=1 SV=1
8	Q94JV1	4.28e-38	144	562	0.258	0.149	Q94JV1_ARATH Appr-1-p processing enzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At1g69340 PE=1 SV=1
9	P67343	2.90e-32	122	266	0.225	0.274	ADPRH_STAAM Protein-ADP-ribose hydrolase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0325 PE=1 SV=1
10	Q8H114	3.61e-32	122	257	0.203	0.257	Q8H114_ARATH Appr-1-p processing enzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At2g40600 PE=1 SV=1
11	Q9DBL2	1.11e-30	123	498	0.203	0.133	GDAP2_MOUSE Ganglioside-induced differentiation-associated protein 2 OS=Mus musculus OX=10090 GN=Gdap2 PE=1 SV=1
12	Q9NXN4	1.18e-30	122	497	0.203	0.133	GDAP2_HUMAN Ganglioside-induced differentiation-associated protein 2 OS=Homo sapiens OX=9606 GN=GDAP2 PE=1 SV=1
13	P0DN70	9.94e-30	116	270	0.271	0.326	ADPRH_STRPG Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) OX=160491 GN=SpyM50868 PE=1 SV=1
14	Q7JUR6	1.73e-21	97.1	540	0.206	0.124	GDAP2_DROME Protein GDAP2 homolog OS=Drosophila melanogaster OX=7227 GN=Gdap2 PE=2 SV=1
15	Q2EMV9	3.27e-19	90.9	1817	0.151	0.027	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
16	Q460N5	6.65e-18	87.0	1801	0.166	0.030	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
17	Q8CAS9	1.39e-16	82.8	866	0.142	0.053	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
18	Q8IXQ6	1.12e-14	77.0	854	0.132	0.050	PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9 OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=2
19	P9WK29	4.06e-14	74.3	359	0.169	0.153	Y1899_MYCTU Uncharacterized protein Rv1899c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1899c PE=1 SV=1
20	Q9QZQ8	3.00e-13	72.0	369	0.126	0.111	H2AY_MOUSE Core histone macro-H2A.1 OS=Mus musculus OX=10090 GN=Macroh2a1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01661 Macro	1.2e-37	139.9	Macro domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255681

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355759	0.897	Poly [ADP-ribose] polymerase 1
2	9606.ENSP00000362273	0.862	Poly(ADP-ribose) glycohydrolase ARH3
3	9606.ENSP00000384408	0.841	Poly(ADP-ribose) glycohydrolase
4	9606.ENSP00000420484	0.839	O-acetyl-ADP-ribose deacetylase 1
5	9606.ENSP00000405330	0.781	Estrogen receptor
6	9606.ENSP00000380258	0.717	ADP-ribosyltransferase 5
7	9606.ENSP00000250693	0.705	GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1
8	9606.ENSP00000362352	0.704	Core histone macro-H2A.2
9	9606.ENSP00000308461	0.703	Rho-related GTP-binding protein Rho6
10	9606.ENSP00000373487	0.701	Keratin, type I cytoskeletal 18
11	9606.ENSP00000325618	0.686	Poly [ADP-ribose] polymerase 10
12	9606.ENSP00000344254	0.682	FXYD domain-containing ion transport regulator 5
13	9606.ENSP00000404464	0.679	Collagen and calcium-binding EGF domain-containing protein 1
14	9606.ENSP00000373979	0.646	Trafficking protein particle complex subunit 9
15	9606.ENSP00000250416	0.642	Poly [ADP-ribose] polymerase 2
16	9606.ENSP00000422375	0.634	U8 snoRNA-decapping enzyme
17	9606.ENSP00000290431	0.604	Polycystic kidney disease 2-like 2 protein
18	9606.ENSP00000430684	0.604	Inhibitor of nuclear factor kappa-B kinase subunit beta
19	9606.ENSP00000352257	0.593	X-ray repair cross-complementing protein 6
20	9606.ENSP00000202967	0.591	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019213	1.000	deacetylase activity
GO:0016799	1.000	hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0097159	0.624	organic cyclic compound binding
GO:1901363	0.620	heterocyclic compound binding
GO:0140293	0.440	ADP-ribosylglutamate hydrolase activity
GO:0003676	0.305	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0006974	0.994	cellular response to DNA damage stimulus
GO:0006139	0.993	nucleobase-containing compound metabolic process
GO:0055086	0.979	nucleobase-containing small molecule metabolic process
GO:0043170	0.965	macromolecule metabolic process
GO:0072521	0.950	purine-containing compound metabolic process
GO:1901657	0.948	glycosyl compound metabolic process
GO:0036211	0.928	protein modification process
GO:0009116	0.871	nucleoside metabolic process
GO:0042278	0.803	purine nucleoside metabolic process
GO:0065007	0.757	biological regulation
GO:0050789	0.733	regulation of biological process
GO:0050794	0.685	regulation of cellular process
GO:0019222	0.397	regulation of metabolic process
GO:0051171	0.378	regulation of nitrogen compound metabolic process
GO:0080090	0.371	regulation of primary metabolic process
GO:0048519	0.368	negative regulation of biological process
GO:0060255	0.365	regulation of macromolecule metabolic process
GO:0031323	0.362	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.973	cytoplasm
GO:0043232	0.317	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.

[back to server]