StarFunc result for job id Q9BQ83

User Input

>input (275 residues)
MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGR
GPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRA
PPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQG
DPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEK
SLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQ83	1.000	1.000	4.942E-58	275	1.000	1.000	Q9BQ83.pdb.gz	SLX1_HUMAN Structure-specific endonuclease subunit SLX1 OS=Homo sapiens OX=9606 GN=SLX1A PE=1 SV=1
2	AFDB:Q8BX32	0.885	0.901	5.490E-43	270	0.742	0.756	Q8BX32.pdb.gz	SLX1_MOUSE Structure-specific endonuclease subunit SLX1 OS=Mus musculus OX=10090 GN=Slx1b PE=2 SV=1
3	AFDB:Q9VN41	0.803	0.747	4.014E-27	297	0.415	0.384	Q9VN41.pdb.gz	SLX1_DROME Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila melanogaster OX=7227 GN=slx1 PE=1 SV=3
4	AFDB:P91351	0.750	0.475	2.232E-24	443	0.335	0.208	P91351.pdb.gz	SLX1_CAEEL Structure-specific endonuclease subunit SLX1 homolog OS=Caenorhabditis elegans OX=6239 GN=slx-1 PE=1 SV=1
5	AFDB:Q9P7M3	0.654	0.663	8.402E-17	271	0.262	0.266	Q9P7M3.pdb.gz	SLX1_SCHPO Structure-specific endonuclease subunit slx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slx1 PE=1 SV=1
6	AFDB:P38324	0.641	0.585	4.965E-14	304	0.262	0.237	P38324.pdb.gz	SLX1_YEAST Structure-specific endonuclease subunit SLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLX1 PE=1 SV=1
7	PDB:3k1lA	0.187	0.141	1.061E-1	376	0.073	0.053	3k1lA.pdb.gz	The structure of the catalytic subunit FANCL of the Fanconi anemia core complex
8	PDB:5mrcd	0.233	0.296	2.200E-1	206	0.069	0.092	5mrcd.pdb.gz	The structure of the yeast mitochondrial ribosome.
9	AFDB:Q91VL9	0.102	0.055	4.817E-1	713	0.055	0.021	Q91VL9.pdb.gz	ZBTB1_MOUSE Zinc finger and BTB domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zbtb1 PE=1 SV=1
10	AFDB:Q9LS14	0.178	0.187	6.936E-1	259	0.047	0.050	Q9LS14.pdb.gz	Q9LS14_ARATH At5g38070 OS=Arabidopsis thaliana OX=3702 GN=At5g38070 PE=2 SV=1
11	AFDB:Q1JPM3	0.139	0.082	8.323E-1	522	0.040	0.021	Q1JPM3.pdb.gz	Q1JPM3_ARATH At1g77250 OS=Arabidopsis thaliana OX=3702 GN=At1g77250 PE=1 SV=1
12	AFDB:Q9FJJ6	0.172	0.157	9.399E-1	307	0.044	0.039	Q9FJJ6.pdb.gz	Q9FJJ6_ARATH AT5g62460/K19B1_7 OS=Arabidopsis thaliana OX=3702 GN=RZFP PE=1 SV=1
13	PDB:7abzP	0.088	0.170	1.737	114	0.025	0.061	7abzP.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
14	PDB:3w5kB	0.095	0.176	2.658	110	0.062	0.155	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
15	PDB:1vokA	0.114	0.149	3.190	192	0.062	0.089	1vokA.pdb.gz
16	PDB:5nf4A	0.110	0.103	3.190	295	0.033	0.031	5nf4A.pdb.gz
17	PDB:1xdpA	0.119	0.058	3.390	687	0.058	0.023	1xdpA.pdb.gz	Crystal structure of a polyphosphate kinase and its implications for polyphosphate synthesis
18	PDB:6akjB	0.117	0.233	3.390	110	0.018	0.045	6akjB.pdb.gz
19	PDB:5tbyA	0.081	0.028	3.828	954	0.018	0.005	5tbyA.pdb.gz
20	PDB:4fjcE	0.058	0.040	4.068	434	0.004	0.002	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQ83	0.0	554	275	1.000	1.000	SLX1_HUMAN Structure-specific endonuclease subunit SLX1 OS=Homo sapiens OX=9606 GN=SLX1A PE=1 SV=1
2	Q8BX32	3.67e-136	387	270	0.745	0.759	SLX1_MOUSE Structure-specific endonuclease subunit SLX1 OS=Mus musculus OX=10090 GN=Slx1b PE=2 SV=1
3	Q9VN41	4.43e-59	191	297	0.385	0.357	SLX1_DROME Structure-specific endonuclease subunit SLX1 homolog OS=Drosophila melanogaster OX=7227 GN=slx1 PE=1 SV=3
4	P91351	7.22e-48	166	443	0.349	0.217	SLX1_CAEEL Structure-specific endonuclease subunit SLX1 homolog OS=Caenorhabditis elegans OX=6239 GN=slx-1 PE=1 SV=1
5	Q9P7M3	1.72e-30	117	271	0.265	0.269	SLX1_SCHPO Structure-specific endonuclease subunit slx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slx1 PE=1 SV=1
6	P38324	1.13e-20	91.3	304	0.276	0.250	SLX1_YEAST Structure-specific endonuclease subunit SLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLX1 PE=1 SV=1
7	Q97PR7	0.041	35.4	99	0.080	0.222	Y1535_STRPN UPF0213 protein SP_1535 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1535 PE=1 SV=1
8	M9PEP2	0.18	35.8	1703	0.062	0.010	M9PEP2_DROME Adenylyl cyclase 13E, isoform C OS=Drosophila melanogaster OX=7227 GN=Ac13E PE=3 SV=1
9	Q6T3S5	0.48	34.3	924	0.065	0.019	Q6T3S5_DROME AMO OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=1
10	Q9VK95	0.48	34.3	924	0.065	0.019	Q9VK95_DROME MIP30126p OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=2
11	Q3TLH4	0.69	33.9	2846	0.062	0.006	PRC2C_MOUSE Protein PRRC2C OS=Mus musculus OX=10090 GN=Prrc2c PE=1 SV=3
12	Q7Z7A1	0.86	33.9	2325	0.036	0.004	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
13	P45472	1.6	30.8	100	0.051	0.140	YHBQ_ECOLI UPF0213 protein YhbQ OS=Escherichia coli (strain K12) OX=83333 GN=yhbQ PE=3 SV=1
14	Q8L7W3	2.0	32.3	878	0.084	0.026	Q8L7W3_ARATH At2g29210/F16P2.41 OS=Arabidopsis thaliana OX=3702 GN=At2g29210 PE=1 SV=1
15	A0A0A0MT39	2.2	32.3	1962	0.069	0.010	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
16	K4DIA1	2.2	32.3	1962	0.069	0.010	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
17	Q14524	2.8	32.0	2016	0.069	0.009	SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=2
18	E9PG18	2.9	32.0	1998	0.069	0.010	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	H9KVD2	2.9	32.0	2016	0.069	0.009	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
20	Q8T913	2.9	31.6	381	0.095	0.068	FANCL_DROME E3 ubiquitin-protein ligase Fancl OS=Drosophila melanogaster OX=7227 GN=Fancl PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01541 GIY-YIG	2.8e-09	48.4	GIY-YIG catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328940

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294008	0.999	Structure-specific endonuclease subunit SLX4
2	9606.ENSP00000307853	0.977	Crossover junction endonuclease MUS81
3	9606.ENSP00000251303	0.930	SLX1 structure-specific endonuclease subunit homolog A (S. cerevisiae)
4	9606.ENSP00000310520	0.911	DNA repair endonuclease XPF
5	9606.ENSP00000376952	0.907	Crossover junction endonuclease EME1
6	9606.ENSP00000347232	0.898	Bloom syndrome protein
7	9606.ENSP00000318977	0.875	Flap endonuclease GEN homolog 1
8	9606.ENSP00000013807	0.861	DNA excision repair protein ERCC-1
9	9606.ENSP00000442336	0.859	DNA topoisomerase 3-alpha
10	9606.ENSP00000267430	0.854	Fanconi anemia group M protein
11	9606.ENSP00000317039	0.841	RecQ-mediated genome instability protein 1
12	9606.ENSP00000335557	0.828	SLX4 interacting protein
13	9606.ENSP00000355506	0.814	Exonuclease 1
14	9606.ENSP00000372088	0.810	DNA repair protein RAD51 homolog 1
15	9606.ENSP00000287647	0.789	Fanconi anemia group D2 protein
16	9606.ENSP00000351284	0.784	DNA repair protein RAD52 homolog
17	9606.ENSP00000265081	0.778	DNA mismatch repair protein Msh3
18	9606.ENSP00000360310	0.773	Meiotic recombination protein SPO11
19	9606.ENSP00000298139	0.770	Werner syndrome ATP-dependent helicase
20	9606.ENSP00000466121	0.767	Fanconi anemia core complex-associated protein 24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008821	1.000	crossover junction DNA endonuclease activity
GO:0017108	1.000	5'-flap endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0050794	0.995	regulation of cellular process
GO:0043170	0.995	macromolecule metabolic process
GO:0032204	0.992	regulation of telomere maintenance
GO:0000723	0.990	telomere maintenance
GO:0006281	0.987	DNA repair
GO:0044085	0.978	cellular component biogenesis
GO:0006310	0.977	DNA recombination
GO:0048523	0.941	negative regulation of cellular process
GO:0006302	0.930	double-strand break repair
GO:0000724	0.873	double-strand break repair via homologous recombination
GO:0045934	0.869	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.824	negative regulation of macromolecule metabolic process
GO:0051053	0.792	negative regulation of DNA metabolic process
GO:0051129	0.544	negative regulation of cellular component organization
GO:0010639	0.492	negative regulation of organelle organization
GO:0048518	0.462	positive regulation of biological process
GO:0022607	0.449	cellular component assembly
GO:0048522	0.439	positive regulation of cellular process
GO:1904356	0.375	regulation of telomere maintenance via telomere lengthening
GO:2001251	0.371	negative regulation of chromosome organization
GO:0010833	0.308	telomere maintenance via telomere lengthening
GO:0009893	0.303	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:0000228	0.998	nuclear chromosome
GO:0033557	0.775	Slx1-Slx4 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.21.-	1.000	Endodeoxyribonucleases producing 5'-phosphomonoesters.
EC:3.1.21.10	1.000	crossover junction endodeoxyribonuclease.

[back to server]