StarFunc result for job id Q9BQ87

User Input

>input (522 residues)
MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYV
EAEISINKDGTVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAK
AATMTPAAISQQNPPKNREATVNGEENGAHEINNHSKPMEIDGDVEIPPNKATVLRGHES
EVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTS
LDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTT
IIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDHPVKTFQGHTN
EVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPN
SSIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWN
TQSGSLVHSYQGTGGIFEVCWNARGDKVGASASDGSVCVLDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60907	0.722	0.655	5.280E-93	577	0.914	0.827	O60907.pdb.gz	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
2	AFDB:Q8BHJ5	0.727	0.738	2.149E-87	514	0.841	0.854	Q8BHJ5.pdb.gz	TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus OX=10090 GN=Tbl1xr1 PE=1 SV=1
3	AFDB:Q95RJ9	0.704	0.528	1.497E-71	700	0.703	0.524	Q95RJ9.pdb.gz	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
4	AFDB:Q9FN19	0.696	0.596	1.492E-61	613	0.498	0.424	Q9FN19.pdb.gz	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
5	AFDB:P38262	0.591	0.578	2.711E-33	535	0.243	0.237	P38262.pdb.gz	SIF2_YEAST SIR4-interacting protein SIF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIF2 PE=1 SV=2
6	AFDB:O74845	0.607	0.564	1.013E-31	564	0.232	0.215	O74845.pdb.gz	HIF2_SCHPO Set3 complex subunit hif2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hif2 PE=1 SV=1
7	AFDB:Q9VPR4	0.593	0.633	1.494E-28	488	0.197	0.211	Q9VPR4.pdb.gz	NLE_DROME Protein Notchless OS=Drosophila melanogaster OX=7227 GN=Nle PE=1 SV=2
8	AFDB:Q8RXQ4	0.606	0.772	3.744E-28	407	0.167	0.214	Q8RXQ4.pdb.gz	Q8RXQ4_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At1g71840 PE=1 SV=1
9	AFDB:Q8VEJ4	0.597	0.641	1.446E-27	485	0.193	0.208	Q8VEJ4.pdb.gz	NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus OX=10090 GN=Nle1 PE=1 SV=4
10	AFDB:Q3Y8L7	0.593	0.691	2.110E-27	446	0.176	0.206	Q3Y8L7.pdb.gz	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
11	PDB:5mzhB	0.589	0.733	9.391E-27	415	0.178	0.224	5mzhB.pdb.gz
12	PDB:5nnzA	0.582	0.889	1.092E-24	335	0.170	0.266	5nnzA.pdb.gz
13	PDB:7bt6x	0.583	0.622	1.776E-24	488	0.172	0.184	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	PDB:4v7fq	0.588	0.689	1.719E-23	443	0.165	0.194	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
15	PDB:1vyhC	0.474	0.760	3.866E-23	310	0.165	0.277	1vyhC.pdb.gz
16	PDB:5jcsq	0.463	0.493	2.179E-22	488	0.170	0.182	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
17	PDB:7mqaLO	0.396	0.258	1.998E-21	819	0.155	0.099	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:5k1aF	0.470	0.413	2.480E-21	600	0.103	0.090	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
19	PDB:2ybaB	0.464	0.617	2.917E-21	382	0.132	0.181	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
20	PDB:7mq8LR	0.477	0.330	3.621E-21	773	0.142	0.096	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60907	0.0	967	577	0.908	0.821	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
2	Q8BHJ5	0.0	905	514	0.841	0.854	TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus OX=10090 GN=Tbl1xr1 PE=1 SV=1
3	Q95RJ9	0.0	624	700	0.556	0.414	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
4	Q9BQ87	0.0	1088	522	1.000	1.000	TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens OX=9606 GN=TBL1Y PE=1 SV=1
5	Q9BZK7	0.0	899	514	0.843	0.856	TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1
6	Q9QXE7	0.0	975	527	0.925	0.917	TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus OX=10090 GN=Tbl1x PE=1 SV=2
7	Q9FN19	3.90e-153	452	613	0.404	0.344	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
8	P38262	7.74e-44	164	535	0.266	0.260	SIF2_YEAST SIR4-interacting protein SIF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIF2 PE=1 SV=2
9	Q3Y8L7	7.65e-34	135	446	0.174	0.204	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
10	Q8N136	1.61e-33	134	415	0.174	0.219	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
11	Q9D4T2	6.79e-33	129	304	0.172	0.296	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
12	D3Z7A5	1.79e-32	130	415	0.172	0.217	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
13	O74855	3.09e-31	128	502	0.215	0.223	NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsa4 PE=3 SV=1
14	Q57W14	1.11e-30	125	419	0.165	0.205	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
15	Q1LV15	2.47e-30	124	415	0.169	0.212	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
16	O76071	1.47e-29	120	339	0.167	0.257	CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1
17	Q99KN2	1.53e-29	120	339	0.167	0.257	CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus OX=10090 GN=Ciao1 PE=1 SV=1
18	Q8TC44	3.89e-29	122	478	0.157	0.172	POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens OX=9606 GN=POC1B PE=1 SV=1
19	Q9VPR4	4.19e-29	122	488	0.207	0.221	NLE_DROME Protein Notchless OS=Drosophila melanogaster OX=7227 GN=Nle PE=1 SV=2
20	Q9NVX2	2.31e-28	120	485	0.203	0.219	NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens OX=9606 GN=NLE1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.4e-26	103.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	1.9e-07	42.7	Eukaryotic translation initiation factor eIF2A
3	PF16529 Ge1_WD40	0.07	23.7	WD40 region of Ge1, enhancer of mRNA-decapping protein
4	PF00457 Glyco_hydro_11	99	14.0	Glycosyl hydrolases family 11
5	PF04762 IKI3	1.2e+02	12.0	IKI3 family
6	PF03812 KdgT	3.3e+02	12.0	2-keto-3-deoxygluconate permease
7	PF08513 LisH	3.3e-06	38.1	LisH
8	PF20426 NBCH_WD40	1e-07	42.7	Neurobeachin beta propeller domain
9	PF11715 Nup160	34	14.6	Nucleoporin Nup120/160
10	PF00400 WD40	2.2e-46	166.0	WD domain, G-beta repeat
11	PF17005 WD40_like	3.2	18.6	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000037088

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000059137	0.980	Nuclear receptor corepressor 1
2	9598.ENSPTRP00000056927	0.974	Nuclear receptor corepressor 2
3	9598.ENSPTRP00000029652	0.971	Histone deacetylase
4	9598.ENSPTRP00000044466	0.971	Catenin (Cadherin-associated protein), beta 1, 88kDa
5	9598.ENSPTRP00000014796	0.970	G protein pathway suppressor 2
6	9598.ENSPTRP00000026906	0.904	Transducin (Beta)-like 1 X-linked receptor 1
7	9598.ENSPTRP00000061235	0.892	Pan troglodytes protein kinase, X-linked (PRKX), mRNA
8	9598.ENSPTRP00000038652	0.877	Methyl-CpG-binding protein 2
9	9598.ENSPTRP00000060659	0.876	Histone deacetylase
10	9598.ENSPTRP00000033495	0.857	Myeloid/lymphoid or mixed-lineage leukemia 5
11	9598.ENSPTRP00000049696	0.825	Histone deacetylase
12	9598.ENSPTRP00000005208	0.808	Uncharacterized protein
13	9598.ENSPTRP00000004647	0.800	Peptidyl-prolyl cis-trans isomerase
14	9598.ENSPTRP00000051821	0.800	Belongs to the histone H2B family.
15	9598.ENSPTRP00000046774	0.798	SIN3 homolog A, transcription regulator
16	9598.ENSPTRP00000038771	0.796	ATP-dependent RNA helicase DDX3Y
17	9598.ENSPTRP00000040734	0.792	Uncharacterized protein
18	9598.ENSPTRP00000045926	0.792	Neuroligin 4, Y-linked
19	9598.ENSPTRP00000038754	0.786	Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel (By similarity).
20	9598.ENSPTRP00000038766	0.777	USP9Y

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.945	heterocyclic compound binding
GO:0097159	0.945	organic cyclic compound binding
GO:0003676	0.942	nucleic acid binding
GO:0140110	0.917	transcription regulator activity
GO:0003712	0.877	transcription coregulator activity
GO:0001067	0.794	transcription regulatory region nucleic acid binding
GO:0003690	0.742	double-stranded DNA binding
GO:0043565	0.605	sequence-specific DNA binding
GO:0003714	0.571	transcription corepressor activity
GO:0000976	0.500	transcription cis-regulatory region binding
GO:0003824	0.468	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0031326	0.987	regulation of cellular biosynthetic process
GO:0019219	0.985	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0048518	0.957	positive regulation of biological process
GO:0048522	0.953	positive regulation of cellular process
GO:0006807	0.947	nitrogen compound metabolic process
GO:0071704	0.941	organic substance metabolic process
GO:0009987	0.865	cellular process
GO:0048519	0.864	negative regulation of biological process
GO:0006357	0.859	regulation of transcription by RNA polymerase II
GO:0031328	0.847	positive regulation of cellular biosynthetic process
GO:0045935	0.847	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.818	positive regulation of macromolecule metabolic process
GO:1902680	0.781	positive regulation of RNA biosynthetic process
GO:0045893	0.768	positive regulation of DNA-templated transcription
GO:1901564	0.752	organonitrogen compound metabolic process
GO:0048523	0.687	negative regulation of cellular process
GO:0044238	0.634	primary metabolic process
GO:0031324	0.589	negative regulation of cellular metabolic process
GO:0051172	0.578	negative regulation of nitrogen compound metabolic process
GO:0010605	0.571	negative regulation of macromolecule metabolic process
GO:0043170	0.512	macromolecule metabolic process
GO:0045944	0.508	positive regulation of transcription by RNA polymerase II
GO:0006508	0.428	proteolysis
GO:0065008	0.406	regulation of biological quality
GO:0045892	0.380	negative regulation of DNA-templated transcription
GO:0044237	0.347	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.391	protein-containing complex
GO:0043232	0.307	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]