StarFunc result for job id Q9BQ89

User Input

>input (295 residues)
MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVERLEADKAKYVKSLHVA
NTRQEPVQPLLSKQPLFSPETRRTVLTPSRRALPGPCRRPQLDLDILSSLIDLCDSPVSP
AEASRTPGRAEGAGRPPPATPPRPPPSTSAVRRVDVRPLPASPARPCPSPGPAAASSPAR
PPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLARASSDIVSLAGPSAG
PGSSEGGCSRRSSVTVEERARERVPYGVSVVERNARVIKWLYGLRQARESPAAEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQ89	1.000	1.000	9.333E-45	295	1.000	1.000	Q9BQ89.pdb.gz	F110A_HUMAN Protein FAM110A OS=Homo sapiens OX=9606 GN=FAM110A PE=1 SV=1
2	AFDB:Q8R184	0.253	0.252	1.970E-32	296	0.858	0.855	Q8R184.pdb.gz	F110A_MOUSE Protein FAM110A OS=Mus musculus OX=10090 GN=Fam110a PE=2 SV=2
3	AFDB:C1PGW1	0.075	0.074	1.162E-1	300	0.176	0.173	C1PGW1.pdb.gz	TED7_ZINVI Protein TRACHEARY ELEMENT DIFFERENTIATION-RELATED 7A OS=Zinnia violacea OX=34245 GN=TED7 PE=2 SV=1
4	AFDB:Q9WTW1	0.081	0.027	2.456E-1	1043	0.149	0.042	Q9WTW1.pdb.gz	GRIP2_RAT Glutamate receptor-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Grip2 PE=1 SV=1
5	AFDB:Q4W9W8	0.128	0.127	2.783E-1	299	0.163	0.161	Q4W9W8.pdb.gz	Q4W9W8_ASPFU HLH DNA binding domain protein, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G03460 PE=4 SV=1
6	AFDB:A0A024R305	0.094	0.052	4.583E-1	729	0.186	0.075	A0A024R305.pdb.gz
7	AFDB:Q9M0X8	0.108	0.107	4.878E-1	298	0.122	0.121	Q9M0X8.pdb.gz	BH114_ARATH Transcription factor bHLH114 OS=Arabidopsis thaliana OX=3702 GN=BHLH114 PE=2 SV=2
8	AFDB:Q9FWW2	0.079	0.052	5.192E-1	483	0.173	0.106	Q9FWW2.pdb.gz	Q9FWW2_ARATH T28K15.14 protein OS=Arabidopsis thaliana OX=3702 GN=At1g12120 PE=1 SV=1
9	AFDB:Q8I0A1	0.100	0.046	5.526E-1	814	0.156	0.057	Q8I0A1.pdb.gz	Q8I0A1_DROME LD30628p OS=Drosophila melanogaster OX=7227 GN=SNF4Agamma PE=2 SV=1
10	AFDB:Q5H9L2	0.078	0.096	6.663E-1	206	0.112	0.160	Q5H9L2.pdb.gz	TCAL5_HUMAN Transcription elongation factor A protein-like 5 OS=Homo sapiens OX=9606 GN=TCEAL5 PE=1 SV=1
11	PDB:7dvqR	0.073	0.081	6.065	241	0.092	0.112	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:4ob3A	0.077	0.105	7.313	204	0.017	0.025	4ob3A.pdb.gz	The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
13	PDB:6f40W	0.086	0.110	8.284	218	0.064	0.087	6f40W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
14	PDB:6bzoE	0.065	0.152	8.817	83	0.044	0.157	6bzoE.pdb.gz	Fidaxomicin jamsMycobacterium tuberculosisRNA polymerase motions needed for initiation via RbpA contacts.
15	PDB:6lqsr6	0.092	0.221	8.817	104	0.044	0.125	6lqsr6.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
16	PDB:7ungB0	0.085	0.120	9.989	193	0.061	0.093	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQ89	0.0	567	295	1.000	1.000	F110A_HUMAN Protein FAM110A OS=Homo sapiens OX=9606 GN=FAM110A PE=1 SV=1
2	Q8R184	5.24e-159	446	296	0.858	0.855	F110A_MOUSE Protein FAM110A OS=Mus musculus OX=10090 GN=Fam110a PE=2 SV=2
3	Q8TC76	5.35e-53	179	370	0.447	0.357	F110B_HUMAN Protein FAM110B OS=Homo sapiens OX=9606 GN=FAM110B PE=1 SV=1
4	Q4W9P7	0.049	37.7	1084	0.081	0.022	Q4W9P7_ASPFU chitin synthase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G04180 PE=4 SV=1
5	E7F2X0	0.16	36.2	1569	0.098	0.018	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2
6	Q7TPV4	9.5	30.4	1344	0.092	0.020	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14160 FAM110_C	6.9e-28	109.4	Centrosome-associated C terminus
2	PF14161 FAM110_N	6e-29	112.0	Centrosome-associated N terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354163

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262210	0.920	Centrosome and spindle pole-associated protein 1
2	9606.ENSP00000259154	0.758	BTB/POZ domain-containing protein KCTD3
3	9606.ENSP00000365071	0.741	G-patch domain and ankyrin repeats 1
4	9606.ENSP00000378710	0.721	Protein FAM135B
5	9606.ENSP00000286918	0.686	Ankyrin repeat domain-containing protein 9
6	9606.ENSP00000363257	0.683	Palmitoyltransferase ZDHHC18
7	9606.ENSP00000408581	0.643	Transmembrane protein 132D
8	9606.ENSP00000274520	0.642	Interleukin-9
9	9606.ENSP00000418575	0.636	Protein FAM19A1
10	9606.ENSP00000451866	0.605	Small integral membrane protein 13
11	9606.ENSP00000428540	0.602	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
12	9606.ENSP00000005386	0.599	RNA polymerase II-associated protein 3
13	9606.ENSP00000011653	0.553	T-cell surface glycoprotein CD4
14	9606.ENSP00000231449	0.544	Interleukin-4
15	9606.ENSP00000344192	0.544	Interleukin-17A
16	9606.ENSP00000227163	0.540	Transcription factor PU.1
17	9606.ENSP00000231454	0.539	Interleukin-5
18	9606.ENSP00000229135	0.535	Interferon gamma
19	9606.ENSP00000304915	0.535	Interleukin-13
20	9606.ENSP00000365380	0.535	Forkhead box protein P3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.716	regulation of biological process
GO:0050794	0.714	regulation of cellular process
GO:0071840	0.669	cellular component organization or biogenesis
GO:0000278	0.646	mitotic cell cycle
GO:0000226	0.646	microtubule cytoskeleton organization
GO:0022402	0.609	cell cycle process
GO:0048518	0.589	positive regulation of biological process
GO:0007051	0.582	spindle organization
GO:1902850	0.582	microtubule cytoskeleton organization involved in mitosis
GO:0007052	0.567	mitotic spindle organization
GO:0048522	0.404	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0000922	1.000	spindle pole
GO:0005876	1.000	spindle microtubule
GO:0005813	0.999	centrosome
GO:0071944	0.904	cell periphery
GO:0031981	0.337	nuclear lumen
GO:0005654	0.316	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]