StarFunc result for job id Q9BQA5

User Input

>input (517 residues)
MPPPGKVPRKENLWLQCEWGSCSFVCSTMEKFFEHVTQHLQQHLHGSGEEEEEEEEDDPL
EEEFSCLWQECGFCSLDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLGPCILDFQSRN
VIPDIPDHFLCLWEHCENSFDNPEWFYRHVEAHSLCCEYEAVGKDNPVVLCGWKGCTCTF
KDRSKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQHFQCSHCSKRFAT
ERLLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSEDRPFKCDCCDYSCKNLIDLQ
KHLDTHSEEPAYRCDFENCTFSARSLCSIKSHYRKVHEGDSEPRYKCHVCDKCFTRGNNL
TVHLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLN
ESSLQGIILETVPGEPGRKEEEEEGKGSEGTALSASQDNPSSVIHVVNQTNAQGQQEIVY
YVLSEAPGEPPPAPEPPSGGIMEKLQGIAEEPEIQMV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQA5	1.000	1.000	6.493E-104	517	1.000	1.000	Q9BQA5.pdb.gz	HINFP_HUMAN Histone H4 transcription factor OS=Homo sapiens OX=9606 GN=HINFP PE=1 SV=2
2	AFDB:Q8K1K9	0.759	0.779	9.464E-84	503	0.845	0.869	Q8K1K9.pdb.gz	HINFP_MOUSE Histone H4 transcription factor OS=Mus musculus OX=10090 GN=Hinfp PE=2 SV=3
3	AFDB:O77260	0.425	0.467	2.605E-40	467	0.296	0.328	O77260.pdb.gz	O77260_DROME EG:115C2.6 protein OS=Drosophila melanogaster OX=7227 GN=Hinfp PE=2 SV=1
4	AFDB:Q9R1D1	0.155	0.114	1.137E-16	737	0.207	0.145	Q9R1D1.pdb.gz	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
5	AFDB:Q8CJ78	0.262	0.148	3.989E-16	1038	0.215	0.107	Q8CJ78.pdb.gz	ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus OX=10090 GN=Znf628 PE=1 SV=2
6	AFDB:Q5EBL2	0.273	0.148	5.066E-16	1059	0.195	0.095	Q5EBL2.pdb.gz	ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens OX=9606 GN=ZNF628 PE=1 SV=3
7	AFDB:A0A2R8QUZ1	0.161	0.109	1.241E-15	809	0.201	0.129	A0A2R8QUZ1.pdb.gz
8	AFDB:P57071	0.238	0.097	2.059E-14	1507	0.174	0.060	P57071.pdb.gz	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
9	AFDB:M9PCY3	0.286	0.182	2.320E-14	878	0.180	0.106	M9PCY3.pdb.gz	M9PCY3_DROME Crooked legs, isoform G OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
10	AFDB:Q6ECI4	0.285	0.215	2.320E-14	717	0.186	0.134	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
11	PDB:3w5kB	0.101	0.316	8.137E-3	110	0.056	0.264	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5apny	0.054	0.107	7.881E-2	211	0.060	0.147	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
13	PDB:7o72Q	0.045	0.089	5.024E-1	222	0.039	0.090	7o72Q.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:6o9lQ	0.060	0.070	1.160	430	0.081	0.098	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:1b8tA	0.050	0.110	1.660	192	0.044	0.120	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
16	PDB:7pmkQ	0.068	0.051	2.842	766	0.064	0.043	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
17	PDB:6bqrA	0.087	0.054	4.583	948	0.037	0.020	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
18	PDB:3jcmI	0.043	0.049	5.483	416	0.035	0.043	3jcmI.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
19	PDB:5wp6A	0.086	0.052	5.820	977	0.037	0.019	5wp6A.pdb.gz	Electron cryo-microscopy structure of a human TRPM4 channel.
20	PDB:1n6zA	0.044	0.161	6.179	105	0.010	0.048	1n6zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K1K9	0.0	855	503	0.839	0.863	HINFP_MOUSE Histone H4 transcription factor OS=Mus musculus OX=10090 GN=Hinfp PE=2 SV=3
2	Q9BQA5	0.0	1075	517	1.000	1.000	HINFP_HUMAN Histone H4 transcription factor OS=Homo sapiens OX=9606 GN=HINFP PE=1 SV=2
3	O77260	1.97e-81	263	467	0.279	0.308	O77260_DROME EG:115C2.6 protein OS=Drosophila melanogaster OX=7227 GN=Hinfp PE=2 SV=1
4	Q6JAA4	1.57e-21	100	798	0.122	0.079	Q6JAA4_DANRE CCCTC-binding factor OS=Danio rerio OX=7955 GN=im:7152666 PE=1 SV=1
5	Q8TF68	2.52e-21	99.8	577	0.128	0.114	ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens OX=9606 GN=ZNF384 PE=1 SV=2
6	Q08705	2.85e-21	100	728	0.122	0.087	CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus OX=9031 GN=CTCF PE=1 SV=1
7	Q61164	4.79e-21	99.4	736	0.122	0.086	CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus OX=10090 GN=Ctcf PE=1 SV=2
8	P49711	4.86e-21	99.4	727	0.122	0.087	CTCF_HUMAN Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1
9	A0A2R8YFL0	5.16e-21	99.0	725	0.122	0.087	A0A2R8YFL0_HUMAN CCCTC-binding factor OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1
10	Q9R1D1	5.29e-21	99.0	737	0.122	0.085	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
11	Q9EQJ4	6.99e-21	98.2	579	0.126	0.112	ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus OX=10116 GN=Znf384 PE=1 SV=1
12	Q9H5H4	3.55e-20	95.9	540	0.126	0.120	ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2
13	A2A761	4.18e-20	95.9	587	0.135	0.119	ZFP69_MOUSE Zinc finger protein 69 OS=Mus musculus OX=10090 GN=Zfp69 PE=3 SV=1
14	Q9Z117	4.76e-20	95.9	652	0.143	0.113	Q9Z117_MOUSE KRAB-containing zinc-finger protein KRAZ1 OS=Mus musculus OX=10090 GN=Zfp53 PE=1 SV=1
15	M9PD94	6.29e-20	95.9	907	0.155	0.088	M9PD94_DROME Crooked legs, isoform F OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
16	Q9UEG4	9.79e-20	95.5	869	0.130	0.077	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
17	Q68EA5	1.03e-19	94.7	555	0.159	0.148	ZNF57_HUMAN Zinc finger protein 57 OS=Homo sapiens OX=9606 GN=ZNF57 PE=1 SV=3
18	Q8N988	1.59e-19	93.2	423	0.132	0.161	ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens OX=9606 GN=ZNF557 PE=1 SV=2
19	Q96MU6	1.61e-19	94.4	729	0.143	0.102	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
20	Q8N393	1.80e-19	94.4	782	0.137	0.091	ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens OX=9606 GN=ZNF786 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17003 Actin_micro	34	15.1	Putative actin-like family
2	PF09111 SLIDE	2.2e+02	13.3	SLIDE
3	PF00096 zf-C2H2	4.7e-13	60.0	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	3e-12	57.2	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	5.7	18.6	Zinc-finger double-stranded RNA-binding
6	PF13913 zf-C2HC_2	2.2e+02	13.2	zinc-finger of a C2HC-type
7	PF05605 zf-Di19	36	16.1	Drought induced 19 protein (Di19), zinc-binding
8	PF02701 zf-Dof	38	15.9	Dof domain, zinc finger
9	PF13465 zf-H2C2_2	5.4e-12	56.8	Zinc-finger double domain
10	PF13909 zf-H2C2_5	77	14.5	C2H2-type zinc-finger domain
11	PF12874 zf-met	11	17.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278612	0.904	Protein NPAT
2	9606.ENSP00000262027	0.642	Methionine--tRNA ligase, cytoplasmic
3	9606.ENSP00000357040	0.608	Vang-like protein 2
4	9606.ENSP00000304286	0.603	Forkhead box protein I1
5	9606.ENSP00000319341	0.600	U7 snRNA-associated Sm-like protein LSm10
6	9606.ENSP00000300093	0.599	Serine/threonine-protein kinase PLK1
7	9606.ENSP00000346886	0.592	GA-binding protein alpha chain
8	9606.ENSP00000463287	0.584	Kruppel like factor 14
9	9606.ENSP00000354476	0.578	Sterol regulatory element-binding protein 2
10	9606.ENSP00000256429	0.575	Methyl-CpG-binding domain protein 2
11	9606.ENSP00000334294	0.575	Transcription factor-like 5 protein
12	9606.ENSP00000377401	0.566	Adenosine 3'-phospho 5'-phosphosulfate transporter 1
13	9606.ENSP00000484789	0.560	Histone H4
14	9606.ENSP00000244537	0.556	Histone cluster 1 H4 family member f
15	9606.ENSP00000347168	0.556	Histone cluster 1 H4 family member j
16	9606.ENSP00000366956	0.556	Histone cluster 1 H4 family member h
17	9606.ENSP00000366974	0.556	Histone cluster 1 H4 family member b
18	9606.ENSP00000367034	0.556	Histone cluster 1 H4 family member c
19	9606.ENSP00000443017	0.556	Histone cluster 4, H4
20	9606.ENSP00000462355	0.556	Histone cluster 2 H4 family member b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0042393	0.994	histone binding
GO:0001228	0.991	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019899	0.974	enzyme binding
GO:0000987	0.936	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.916	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.697	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003682	0.620	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0010468	0.995	regulation of gene expression
GO:1903506	0.995	regulation of nucleic acid-templated transcription
GO:0006355	0.964	regulation of DNA-templated transcription
GO:0048518	0.948	positive regulation of biological process
GO:0006357	0.929	regulation of transcription by RNA polymerase II
GO:0071704	0.926	organic substance metabolic process
GO:0031324	0.925	negative regulation of cellular metabolic process
GO:0044238	0.901	primary metabolic process
GO:0051172	0.899	negative regulation of nitrogen compound metabolic process
GO:0048522	0.897	positive regulation of cellular process
GO:0044237	0.885	cellular metabolic process
GO:0010605	0.885	negative regulation of macromolecule metabolic process
GO:0045892	0.877	negative regulation of DNA-templated transcription
GO:0009893	0.874	positive regulation of metabolic process
GO:0006807	0.873	nitrogen compound metabolic process
GO:0010604	0.861	positive regulation of macromolecule metabolic process
GO:0051173	0.841	positive regulation of nitrogen compound metabolic process
GO:0031325	0.841	positive regulation of cellular metabolic process
GO:0043170	0.840	macromolecule metabolic process
GO:0045935	0.759	positive regulation of nucleobase-containing compound metabolic process
GO:1901360	0.751	organic cyclic compound metabolic process
GO:0006725	0.749	cellular aromatic compound metabolic process
GO:0034641	0.747	cellular nitrogen compound metabolic process
GO:0046483	0.746	heterocycle metabolic process
GO:0031328	0.715	positive regulation of cellular biosynthetic process
GO:0006139	0.649	nucleobase-containing compound metabolic process
GO:0051254	0.648	positive regulation of RNA metabolic process
GO:0010557	0.629	positive regulation of macromolecule biosynthetic process
GO:0045893	0.619	positive regulation of DNA-templated transcription
GO:0090304	0.600	nucleic acid metabolic process
GO:0050896	0.455	response to stimulus
GO:0000122	0.360	negative regulation of transcription by RNA polymerase II
GO:0045944	0.350	positive regulation of transcription by RNA polymerase II
GO:0051716	0.337	cellular response to stimulus
GO:0051726	0.308	regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.954	nuclear body
GO:0043232	0.866	intracellular non-membrane-bounded organelle
GO:0015030	0.757	Cajal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]