StarFunc result for job id Q9BQB4

User Input

>input (213 residues)
MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAE
NGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIG
RGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELK
DFGTEAARPQKGRKPRPRARSAKANQAELENAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQB4	1.000	1.000	1.284E-32	213	1.000	1.000	Q9BQB4.pdb.gz	SOST_HUMAN Sclerostin OS=Homo sapiens OX=9606 GN=SOST PE=1 SV=1
2	AFDB:Q99P67	0.713	0.713	4.018E-29	213	0.897	0.897	Q99P67.pdb.gz	SOST_RAT Sclerostin OS=Rattus norvegicus OX=10116 GN=Sost PE=2 SV=1
3	PDB:2k8pA	0.405	0.449	1.890E-24	189	0.887	1.000	2k8pA.pdb.gz
4	AFDB:Q6X4U4	0.440	0.454	1.486E-14	206	0.371	0.383	Q6X4U4.pdb.gz	SOSD1_HUMAN Sclerostin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SOSTDC1 PE=1 SV=2
5	PDB:5hk5F	0.309	0.492	3.481E-3	129	0.117	0.194	5hk5F.pdb.gz
6	PDB:4my2A	0.291	0.140	4.879E-3	474	0.099	0.044	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
7	PDB:1hcnB	0.300	0.510	9.586E-3	110	0.122	0.236	1hcnB.pdb.gz
8	PDB:5vqfB	0.255	0.179	3.700E-2	320	0.099	0.066	5vqfB.pdb.gz
9	PDB:7uwmA	0.208	0.347	6.873E-2	109	0.085	0.165	7uwmA.pdb.gz
10	PDB:7y1rB	0.250	0.184	8.137E-2	308	0.089	0.062	7y1rB.pdb.gz
11	PDB:4mqwB	0.294	0.517	9.106E-2	109	0.080	0.156	4mqwB.pdb.gz
12	PDB:1wq8A	0.215	0.374	1.019E-1	100	0.070	0.150	1wq8A.pdb.gz
13	PDB:5nxsA	0.238	0.185	1.141E-1	290	0.094	0.069	5nxsA.pdb.gz
14	AFDB:G8BHR4	0.138	0.060	2.630E-1	584	0.127	0.046	G8BHR4.pdb.gz	G8BHR4_CANPC chitinase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CHT2 PE=3 SV=1
15	AFDB:Q6FUW3	0.121	0.044	8.575E-1	975	0.122	0.027	Q6FUW3.pdb.gz	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1
16	AFDB:Q24573	0.128	0.036	1.345	911	0.178	0.042	Q24573.pdb.gz	DRI_DROME Protein dead ringer OS=Drosophila melanogaster OX=7227 GN=retn PE=1 SV=2
17	AFDB:G8BIT3	0.122	0.039	1.423	812	0.131	0.034	G8BIT3.pdb.gz	G8BIT3_CANPC Flo11 domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=RBT1 PE=4 SV=1
18	AFDB:Q04433	0.122	0.060	2.232	528	0.141	0.057	Q04433.pdb.gz	FIT1_YEAST Facilitator of iron transport 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIT1 PE=2 SV=1
19	AFDB:P53253	0.138	0.049	2.643	936	0.108	0.025	P53253.pdb.gz	NNF2_YEAST Protein NNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNF2 PE=1 SV=1
20	AFDB:A2A653	0.134	0.101	2.958	289	0.117	0.087	A2A653.pdb.gz	A2A653_MOUSE Bromodomain PHD finger transcription factor (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQB4	4.30e-159	439	213	1.000	1.000	SOST_HUMAN Sclerostin OS=Homo sapiens OX=9606 GN=SOST PE=1 SV=1
2	Q99P67	7.14e-142	396	213	0.897	0.897	SOST_RAT Sclerostin OS=Rattus norvegicus OX=10116 GN=Sost PE=2 SV=1
3	Q99P68	2.38e-137	385	211	0.873	0.882	SOST_MOUSE Sclerostin OS=Mus musculus OX=10090 GN=Sost PE=1 SV=2
4	Q9CQN4	1.10e-36	129	206	0.366	0.379	SOSD1_MOUSE Sclerostin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sostdc1 PE=1 SV=1
5	Q6X4U4	1.61e-36	129	206	0.380	0.393	SOSD1_HUMAN Sclerostin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SOSTDC1 PE=1 SV=2
6	Q76C29	0.003	39.7	243	0.141	0.123	Q76C29_DANRE DAN domain family, member 5 precursor OS=Danio rerio OX=7955 GN=charon PE=2 SV=1
7	Q76LW6	0.004	39.3	185	0.141	0.162	DAND5_MOUSE DAN domain family member 5 OS=Mus musculus OX=10090 GN=Dand5 PE=2 SV=1
8	A0A0H2UMZ1	0.23	33.5	155	0.150	0.206	A0A0H2UMZ1_STRPN tRNA-specific adenosine deaminase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=tadA PE=1 SV=1
9	F4JCR3	1.7	32.0	1607	0.075	0.010	F4JCR3_ARATH Ubiquitin carboxyl-terminal hydrolase-related protein OS=Arabidopsis thaliana OX=3702 GN=At3g47910 PE=1 SV=1
10	Q9H772	2.2	30.8	168	0.117	0.149	GREM2_HUMAN Gremlin-2 OS=Homo sapiens OX=9606 GN=GREM2 PE=1 SV=1
11	O88273	2.5	30.8	168	0.117	0.149	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
12	G5EFX6	2.9	31.6	1410	0.099	0.015	SLIT1_CAEEL Slit homolog 1 protein OS=Caenorhabditis elegans OX=6239 GN=slt-1 PE=1 SV=1
13	E9Q5F9	4.1	30.8	2537	0.089	0.007	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
14	Q69Z37	6.0	30.4	1561	0.066	0.009	SAM9L_MOUSE Sterile alpha motif domain-containing protein 9-like OS=Mus musculus OX=10090 GN=Samd9l PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	2.6	19.7	Cystine-knot domain
2	PF03045 DAN	3.2e-22	90.1	DAN domain
3	PF05463 Sclerostin	3.1e-89	309.5	Sclerostin (SOST)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261349	0.999	Low-density lipoprotein receptor-related protein 6
2	9606.ENSP00000294304	0.999	Low-density lipoprotein receptor-related protein 5
3	9606.ENSP00000454071	0.973	Low-density lipoprotein receptor
4	9606.ENSP00000328181	0.971	Noggin
5	9606.ENSP00000284523	0.965	Protein Wnt-3a
6	9606.ENSP00000293549	0.957	Proto-oncogene Wnt-1
7	9606.ENSP00000426653	0.940	Protein Wnt-8a
8	9606.ENSP00000287934	0.939	Frizzled-1
9	9606.ENSP00000340677	0.939	Protein Wnt-8b
10	9606.ENSP00000363826	0.930	Frizzled-8
11	9606.ENSP00000323901	0.918	Frizzled-2
12	9606.ENSP00000282091	0.882	Parathyroid hormone
13	9606.ENSP00000363081	0.878	Dickkopf-related protein 1
14	9606.ENSP00000381775	0.865	Tumor necrosis factor ligand superfamily member 11
15	9606.ENSP00000357255	0.846	Osteocalcin
16	9606.ENSP00000297350	0.823	Tumor necrosis factor receptor superfamily member 11B
17	9606.ENSP00000237837	0.812	Fibroblast growth factor 23
18	9606.ENSP00000367888	0.805	Low-density lipoprotein receptor-related protein 4
19	9606.ENSP00000368682	0.794	Phosphate-regulating neutral endopeptidase
20	9606.ENSP00000360493	0.787	Runt-related transcription factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.647	molecular function regulator activity
GO:0005102	0.390	signaling receptor binding
GO:0030546	0.375	signaling receptor activator activity
GO:0048018	0.368	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048523	0.993	negative regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0032501	0.991	multicellular organismal process
GO:0009987	0.989	cellular process
GO:0023051	0.988	regulation of signaling
GO:0010646	0.987	regulation of cell communication
GO:0048583	0.986	regulation of response to stimulus
GO:0048585	0.978	negative regulation of response to stimulus
GO:0090288	0.967	negative regulation of cellular response to growth factor stimulus
GO:0090101	0.956	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030514	0.952	negative regulation of BMP signaling pathway
GO:0051716	0.945	cellular response to stimulus
GO:0030178	0.940	negative regulation of Wnt signaling pathway
GO:0071773	0.925	cellular response to BMP stimulus
GO:0001503	0.898	ossification
GO:0060828	0.896	regulation of canonical Wnt signaling pathway
GO:0090090	0.877	negative regulation of canonical Wnt signaling pathway
GO:0007178	0.871	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051239	0.853	regulation of multicellular organismal process
GO:0048518	0.790	positive regulation of biological process
GO:0019222	0.768	regulation of metabolic process
GO:0060255	0.756	regulation of macromolecule metabolic process
GO:0032502	0.701	developmental process
GO:0030509	0.662	BMP signaling pathway
GO:0048522	0.635	positive regulation of cellular process
GO:0048856	0.629	anatomical structure development
GO:0051171	0.599	regulation of nitrogen compound metabolic process
GO:0080090	0.595	regulation of primary metabolic process
GO:0031323	0.585	regulation of cellular metabolic process
GO:0010468	0.566	regulation of gene expression
GO:0007267	0.555	cell-cell signaling
GO:0009893	0.503	positive regulation of metabolic process
GO:0010604	0.490	positive regulation of macromolecule metabolic process
GO:0007275	0.430	multicellular organism development
GO:0019219	0.427	regulation of nucleobase-containing compound metabolic process
GO:0050793	0.420	regulation of developmental process
GO:0010556	0.416	regulation of macromolecule biosynthetic process
GO:0051252	0.408	regulation of RNA metabolic process
GO:0051241	0.389	negative regulation of multicellular organismal process
GO:0031326	0.361	regulation of cellular biosynthetic process
GO:0048731	0.345	system development
GO:2001141	0.339	regulation of RNA biosynthetic process
GO:1905114	0.335	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0051173	0.318	positive regulation of nitrogen compound metabolic process
GO:0051128	0.310	regulation of cellular component organization
GO:0010557	0.310	positive regulation of macromolecule biosynthetic process
GO:1903506	0.308	regulation of nucleic acid-templated transcription
GO:0031325	0.307	positive regulation of cellular metabolic process
GO:0198738	0.303	cell-cell signaling by wnt
GO:0006355	0.302	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0012505	0.993	endomembrane system
GO:0071944	0.987	cell periphery
GO:0043227	0.966	membrane-bounded organelle
GO:0005737	0.965	cytoplasm
GO:0043231	0.949	intracellular membrane-bounded organelle
GO:0032991	0.938	protein-containing complex
GO:0005615	0.901	extracellular space
GO:0030312	0.741	external encapsulating structure
GO:0031012	0.730	extracellular matrix
GO:0062023	0.721	collagen-containing extracellular matrix
GO:0005794	0.448	Golgi apparatus
GO:0016020	0.368	membrane
GO:0070013	0.345	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]