StarFunc result for job id Q9BQF6

User Input

>input (1050 residues)
MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLP
LQWERSLRNKVISLDHKNKKHIRGCPVTSKSSPERQLKVMLTNVLWTDLGRKFRKTLPRN
DANLCDANKVQSDSLPSTSVDSLETCQKLEPLRQSLNLSERIPRVILTNVLGTELGRKYI
RTPPVTEGSLSDTDNLQSEQLSSSSDGSLESYQNLNPHKSCYLSERGSQRSKTVDDNSAK
QTAHNKEKRRKDDGISLLISDTQPEDLNSGSRGCDHLEQESRNKDVKYSDSKVELTLISR
KTKRRLRNNLPDSQYCTSLDKSTEQTKKQEDDSTISTEFEKPSENYHQDPKLPEEITTKP
TKSDFTKLSSLNSQELTLSNATKSASAGSTTETVENSNSIDIVGISSLVEKDENELNTIE
KPILRGHNEGNQSLISAEPIVVSSDEEGPVEHKSSEILKLQSKQDRETTNENESTSESAL
LELPLITCESVQMSSELCPYNPVMENISSIMPSNEMDLQLDFIFTSVYIGKIKGASKGCV
TITKKYIKIPFQVSLNEISLLVDTTHLKRFGLWKSKDDNHSKRSHAILFFWVSSDYLQEI
QTQLEHSVLSQQSKSSEFIFLELHNPVSQREELKLKDIMTEISIISGELELSYPLSWVQA
FPLFQNLSSKESSFIHYYCVSTCSFPAGVAVAEEMKLKSVSQPSNTDAAKPTYTFLQKQS
SGCYSLSITSNPDEEWREVRHTGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVI
IDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWT
RHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTID
NDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVE
WEVKLKTHRQFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFELPIHLEKW
FPRHVIKTKREDIRELILKLHLQQQKGSSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BUH8	0.360	0.364	0.000	1037	0.705	0.714	Q8BUH8.pdb.gz	SENP7_MOUSE Sentrin-specific protease 7 OS=Mus musculus OX=10090 GN=Senp7 PE=1 SV=1
2	AFDB:Q9BQF6	1.000	1.000	0.000	1050	1.000	1.000	Q9BQF6.pdb.gz	SENP7_HUMAN Sentrin-specific protease 7 OS=Homo sapiens OX=9606 GN=SENP7 PE=1 SV=4
3	PDB:2bkrA	0.162	0.718	2.253E-7	211	0.044	0.218	2bkrA.pdb.gz
4	AFDB:P38800	0.076	0.061	5.994E-4	1345	0.098	0.077	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
5	AFDB:Q06681	0.077	0.060	1.547E-3	1438	0.108	0.079	Q06681.pdb.gz	YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSP2 PE=1 SV=1
6	AFDB:P34288	0.062	0.043	5.476E-3	1605	0.115	0.075	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
7	PDB:1lw3A	0.089	0.167	6.173E-3	513	0.014	0.029	1lw3A.pdb.gz
8	PDB:3cm1A	0.075	0.335	9.408E-3	137	0.015	0.117	3cm1A.pdb.gz
9	PDB:7nkyQ	0.086	0.188	9.916E-3	404	0.026	0.067	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
10	PDB:7nkyO	0.067	0.142	2.559E-2	427	0.027	0.066	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
11	AFDB:Q8CIR4	0.039	0.026	7.624E-2	2028	0.098	0.051	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
12	PDB:2kr0A	0.077	0.161	1.310E-1	407	0.043	0.111	2kr0A.pdb.gz
13	PDB:2l9cA	0.051	0.231	1.310E-1	176	0.020	0.119	2l9cA.pdb.gz
14	PDB:7eu0M	0.074	0.074	1.381E-1	1052	0.024	0.024	7eu0M.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
15	AFDB:Q9ZW32	0.044	0.052	1.594E-1	839	0.099	0.124	Q9ZW32.pdb.gz	Q9ZW32_ARATH At2g29510 OS=Arabidopsis thaliana OX=3702 GN=At2g29510 PE=1 SV=1
16	PDB:1i7fA	0.032	0.097	1.617E-1	228	0.016	0.075	1i7fA.pdb.gz
17	PDB:7eu1M	0.072	0.071	1.617E-1	1055	0.020	0.020	7eu1M.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
18	AFDB:A0A1D8PLJ2	0.051	0.048	1.968E-1	1141	0.122	0.112	A0A1D8PLJ2.pdb.gz	A0A1D8PLJ2_CANAL Bem3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BEM3 PE=4 SV=1
19	AFDB:Q5VT97	0.040	0.037	2.186E-1	1194	0.104	0.091	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
20	AFDB:Q8VD37	0.036	0.044	2.186E-1	806	0.085	0.110	Q8VD37.pdb.gz	SGIP1_MOUSE SH3-containing GRB2-like protein 3-interacting protein 1 OS=Mus musculus OX=10090 GN=Sgip1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BUH8	0.0	1381	1037	0.698	0.707	SENP7_MOUSE Sentrin-specific protease 7 OS=Mus musculus OX=10090 GN=Senp7 PE=1 SV=1
2	Q9BQF6	0.0	2148	1050	1.000	1.000	SENP7_HUMAN Sentrin-specific protease 7 OS=Homo sapiens OX=9606 GN=SENP7 PE=1 SV=4
3	Q9VYJ5	1.38e-57	213	681	0.117	0.181	Q9VYJ5_DROME FI06413p OS=Drosophila melanogaster OX=7227 GN=pira PE=2 SV=3
4	Q9GZR1	2.92e-55	211	1112	0.104	0.098	SENP6_HUMAN Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=2
5	O13769	1.11e-34	144	638	0.099	0.163	ULP2_SCHPO Ubiquitin-like-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ulp2 PE=1 SV=2
6	Q9VRY4	1.56e-30	133	1833	0.070	0.040	Q9VRY4_DROME LD13895p OS=Drosophila melanogaster OX=7227 GN=velo PE=1 SV=3
7	Q8MR14	1.83e-30	131	711	0.070	0.103	Q8MR14_DROME LD44235p OS=Drosophila melanogaster OX=7227 GN=velo PE=1 SV=1
8	F4I133	6.76e-25	114	963	0.092	0.101	F4I133_ARATH Cysteine proteinases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ASP1 PE=1 SV=1
9	Q2PS26	2.57e-17	89.4	584	0.067	0.120	ULP1D_ARATH Ubiquitin-like-specific protease 1D OS=Arabidopsis thaliana OX=3702 GN=ULP1D PE=1 SV=1
10	P40537	1.57e-16	87.4	1034	0.068	0.069	ULP2_YEAST Ubiquitin-like-specific protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULP2 PE=1 SV=1
11	H0Y4F4	1.76e-16	86.7	582	0.035	0.064	H0Y4F4_HUMAN SUMO specific peptidase 6 (Fragment) OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=1
12	F8W6D9	2.43e-16	86.3	685	0.035	0.054	F8W6D9_HUMAN SUMO specific peptidase 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=1
13	Q8RWN0	5.57e-16	84.7	571	0.069	0.126	ULP1C_ARATH Ubiquitin-like-specific protease 1C OS=Arabidopsis thaliana OX=3702 GN=ULP1C PE=1 SV=1
14	Q6IE23	1.07e-14	80.5	475	0.065	0.143	Q6IE23_RAT Sentrin/SUMO-specific protease 17 OS=Rattus norvegicus OX=10116 GN=Senp17 PE=2 SV=1
15	Q09275	1.51e-12	72.8	382	0.065	0.178	ULP4_CAEEL Ubiquitin-like protease 4 OS=Caenorhabditis elegans OX=6239 GN=ulp-4 PE=1 SV=2
16	Q23238	2.63e-12	73.6	893	0.080	0.094	ULP2_CAEEL Ubiquitin-like protease 2 OS=Caenorhabditis elegans OX=6239 GN=ulp-2 PE=1 SV=2
17	A0A1D8PIW0	4.61e-12	72.8	874	0.074	0.089	A0A1D8PIW0_CANAL SUMO protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ULP3 PE=3 SV=1
18	P59110	6.51e-12	72.0	640	0.055	0.091	SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1
19	Q9P0U3	3.21e-11	69.7	644	0.053	0.087	SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens OX=9606 GN=SENP1 PE=1 SV=2
20	Q91ZX6	1.06e-10	68.2	588	0.058	0.104	SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus OX=10090 GN=Senp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02902 Peptidase_C48	2.5e-29	114.2	Ulp1 protease family, C-terminal catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377655

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245304	0.903	Ras-related protein Rap-2a
2	9606.ENSP00000376077	0.895	Small ubiquitin-related modifier 1
3	9606.ENSP00000405965	0.895	Small ubiquitin-related modifier 2
4	9606.ENSP00000253024	0.854	Transcription intermediary factor 1-beta
5	9606.ENSP00000348056	0.840	SUMO-conjugating enzyme UBC9
6	9606.ENSP00000209875	0.820	Chromobox protein homolog 5
7	9606.ENSP00000318635	0.804	Small ubiquitin-related modifier 4
8	9606.ENSP00000401470	0.773	Ran GTPase-activating protein 1
9	9606.ENSP00000409666	0.743	Small ubiquitin-like modifier 3
10	9606.ENSP00000270225	0.739	SUMO-activating enzyme subunit 1
11	9606.ENSP00000246548	0.736	SUMO-activating enzyme subunit 2
12	9606.ENSP00000340505	0.735	Sentrin-specific protease 8
13	9606.ENSP00000377001	0.720	Speckle-type POZ protein
14	9606.ENSP00000287437	0.704	E3 SUMO-protein ligase NSE2
15	9606.ENSP00000327197	0.694	Sentrin-specific protease 5
16	9606.ENSP00000394791	0.674	Sentrin-specific protease 1
17	9606.ENSP00000314029	0.671	Sentrin-specific protease 3
18	9606.ENSP00000426503	0.659	E3 ubiquitin-protein ligase RNF4
19	9606.ENSP00000324792	0.653	NFATC2-interacting protein
20	9606.ENSP00000353863	0.653	Zinc finger protein 148

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.970	catalytic activity
GO:0140096	0.961	catalytic activity, acting on a protein
GO:0016787	0.918	hydrolase activity
GO:0019783	0.908	ubiquitin-like protein peptidase activity
GO:0008234	0.901	cysteine-type peptidase activity
GO:0004197	0.375	cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0018205	0.993	peptidyl-lysine modification
GO:0050896	0.979	response to stimulus
GO:0070646	0.974	protein modification by small protein removal
GO:0050789	0.896	regulation of biological process
GO:0050794	0.878	regulation of cellular process
GO:0009987	0.717	cellular process
GO:0006950	0.684	response to stress
GO:0019222	0.525	regulation of metabolic process
GO:0044419	0.456	biological process involved in interspecies interaction between organisms
GO:0009607	0.455	response to biotic stimulus
GO:0032446	0.410	protein modification by small protein conjugation
GO:0051171	0.372	regulation of nitrogen compound metabolic process
GO:0060255	0.369	regulation of macromolecule metabolic process
GO:0045087	0.345	innate immune response
GO:0080090	0.306	regulation of primary metabolic process
GO:0051607	0.304	defense response to virus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.969	nucleoplasm
GO:0005737	0.953	cytoplasm
GO:0005829	0.761	cytosol
GO:0032991	0.539	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.918	Hydrolases.
EC:3.4.-.-	0.908	Acting on peptide bonds (peptidases).
EC:3.4.22.-	0.375	Cysteine endopeptidases.

[back to server]