StarFunc result for job id Q9BQG0

User Input

>input (1328 residues)
MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEY
LRGRPKGSEMKYALKRLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYD
LHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKA
LVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVGSVNLFS
DENVPRLVNVLKMAASSVKKDRKLPAIALDLLRLALKEDKFPRFWKEVVEQGLLKMQFWP
ASYLCFRLLGAALPLLTKEQLHLVMQGDVIRHYGEHVCTAKLPKQFKFAPEMDDYVGTFL
EGCQDDPERQLAVLVAFSSVTNQGLPVTPTFWRVVRFLSPPALQGYVAWLRAMFLQPDLD
SLVDFSTNNQKKAQDSSLHMPERAVFRLRKWIIFRLVSIVDSLHLEMEEALTEQVARFCL
FHSFFVTKKPTSQIPETKHPFSFPLENQAREAVSSAFFSLLQTLSTQFKQAPGQTQGGQP
WTYHLVQFADLLLNHSHNVTTVTPFTAQQRQAWDRMLQTLKELEAHSAEARAAAFQHLLL
LVGIHLLKSPAESCDLLGDIQTCIRKSLGEKPRRSRTKTIDPQEPPWVEVLVEILLALLA
QPSHLMRQVARSVFGHICSHLTPRALQLILDVLNPETSEDENDRVVVTDDSDERRLKGAE
DKSEEGEDNRSSESEEESEGEESEEEERDGDVDQGFREQLMTVLQAGKALGGEDSENEEE
LGDEAMMALDQSLASLFAEQKLRIQARRDEKNKLQKEKALRRDFQIRVLDLVEVLVTKQP
ENALVLELLEPLLSIIRRSLRSSSSKQEQDLLHKTARIFTHHLCRARRYCHDLGERAGAL
HAQVERLVQQAGRQPDSPTALYHFNASLYLLRVLKGNTAEGCVHETQEKQKAGTDPSHMP
TGPQAASCLDLNLVTRVYSTALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHI
TGPVRPRHQACLLLQKTLSMREVRSCFEDPEWKQLMGQVLAKVTENLRVLGEAQTKAQHQ
QALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMK
TLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAAT
GGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQ
VNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKA
QVRKAGKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35821	0.869	0.859	0.000	1344	0.691	0.682	O35821.pdb.gz	MBB1A_RAT Myb-binding protein 1A OS=Rattus norvegicus OX=10116 GN=Mybbp1a PE=1 SV=2
2	AFDB:Q7TPV4	0.723	0.715	0.000	1344	0.694	0.686	Q7TPV4.pdb.gz	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2
3	AFDB:Q9BQG0	1.000	1.000	0.000	1328	1.000	1.000	Q9BQG0.pdb.gz	MBB1A_HUMAN Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2
4	AFDB:Q5UIP0	0.130	0.087	8.933E-8	2472	0.127	0.068	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
5	AFDB:Q9VW83	0.131	0.108	1.193E-7	1847	0.123	0.089	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
6	AFDB:P49815	0.120	0.100	4.237E-7	1807	0.118	0.087	P49815.pdb.gz	TSC2_HUMAN Tuberin OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=2
7	PDB:3w3zA	0.197	0.239	5.667E-7	1013	0.128	0.168	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
8	PDB:6xu2A	0.158	0.181	1.506E-6	1091	0.111	0.135	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
9	AFDB:P29539	0.152	0.125	1.617E-6	1916	0.135	0.093	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
10	PDB:3w3uA	0.172	0.200	2.787E-6	1030	0.102	0.132	3w3uA.pdb.gz
11	PDB:7zf1B	0.148	0.162	2.996E-6	1179	0.108	0.121	7zf1B.pdb.gz
12	AFDB:B8JID6	0.119	0.096	3.587E-6	1867	0.137	0.097	B8JID6.pdb.gz
13	PDB:6vaeA	0.113	0.121	4.003E-6	1198	0.098	0.109	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
14	PDB:7unkA	0.132	0.154	5.544E-6	1047	0.133	0.168	7unkA.pdb.gz
15	PDB:7mp5A	0.196	0.170	5.749E-6	1629	0.095	0.077	7mp5A.pdb.gz
16	AFDB:A0A0B4K7Q6	0.093	0.074	7.398E-6	2008	0.125	0.083	A0A0B4K7Q6.pdb.gz	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
17	PDB:4a0cA	0.133	0.148	7.407E-6	1155	0.098	0.113	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
18	PDB:7sukSP	0.143	0.104	1.026E-5	2234	0.098	0.058	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
19	AFDB:Q55BD8	0.144	0.192	1.420E-5	899	0.084	0.125	Q55BD8.pdb.gz	Q55BD8_DICDI CLIP-associating protein OS=Dictyostelium discoideum OX=44689 GN=clasp PE=4 SV=1
20	PDB:7r5jB0	0.142	0.119	1.421E-5	1748	0.135	0.102	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I3L1L3	0.0	2525	1252	0.934	0.990	I3L1L3_HUMAN MYB binding protein 1a (Fragment) OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=1
2	O35821	0.0	1716	1344	0.693	0.685	MBB1A_RAT Myb-binding protein 1A OS=Rattus norvegicus OX=10116 GN=Mybbp1a PE=1 SV=2
3	Q7TPV4	0.0	1788	1344	0.694	0.685	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2
4	Q9BQG0	0.0	2707	1328	1.000	1.000	MBB1A_HUMAN Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2
5	O60094	7.17e-24	111	959	0.151	0.210	DPO5_SCHPO rDNA transcriptional regulator pol5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol5 PE=1 SV=2
6	Q9W5E4	0.003	44.7	1133	0.056	0.065	MBB1A_DROME Myb-binding protein 1A OS=Drosophila melanogaster OX=7227 GN=Mybbp1A PE=1 SV=1
7	P39985	0.036	40.8	1022	0.046	0.060	DPO5_YEAST rDNA transcriptional regulator POL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POL5 PE=1 SV=1
8	O13166	0.52	37.0	761	0.043	0.075	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
9	A2ASS6	1.6	35.8	35213	0.028	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
10	Q6FIU8	2.0	35.4	4880	0.021	0.006	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
11	F5HGJ4	3.1	34.7	656	0.025	0.050	PP85_HCMVM Phosphoprotein 85 OS=Human cytomegalovirus (strain Merlin) OX=295027 GN=UL25 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04931 DNA_pol_phi	1.1e-199	677.0	DNA polymerase phi
2	PF20416 DUF6700	2.6e+02	12.4	Domain of unknown function (DUF6700)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370968

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263857	0.978	DNA-directed RNA polymerase I subunit RPA1
2	9606.ENSP00000355541	0.978	HEAT repeat-containing protein 1
3	9606.ENSP00000384302	0.968	WD repeat-containing protein 43
4	9606.ENSP00000387365	0.964	Periodic tryptophan protein 1 homolog
5	9606.ENSP00000444136	0.962	DNA-directed RNA polymerase I subunit RPA2
6	9606.ENSP00000225298	0.958	U3 small nucleolar RNA-associated protein 18 homolog
7	9606.ENSP00000229214	0.944	KRR1 small subunit processome component homolog
8	9606.ENSP00000327179	0.944	U3 small nucleolar RNA-associated protein 4 homolog
9	9606.ENSP00000296792	0.942	U3 small nucleolar RNA-associated protein 15 homolog
10	9606.ENSP00000455106	0.942	Ribosome biogenesis protein BOP1
11	9606.ENSP00000283131	0.939	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
12	9606.ENSP00000339992	0.937	Transcriptional activator Myb
13	9606.ENSP00000367029	0.933	DNA-directed RNA polymerase I subunit RPA49
14	9606.ENSP00000314193	0.932	WD repeat-containing protein 75
15	9606.ENSP00000346725	0.928	Pescadillo homolog
16	9606.ENSP00000380982	0.928	Pumilio homolog 3
17	9606.ENSP00000396673	0.928	pre-rRNA processing protein FTSJ3
18	9606.ENSP00000454836	0.924	Transducin beta-like protein 3
19	9606.ENSP00000371858	0.923	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
20	9606.ENSP00000264279	0.922	Nucleolar protein 58

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	0.998	RNA binding
GO:0005515	0.930	protein binding
GO:0003677	0.921	DNA binding
GO:0043565	0.798	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0080090	0.951	regulation of primary metabolic process
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0051171	0.927	regulation of nitrogen compound metabolic process
GO:0010468	0.895	regulation of gene expression
GO:0019219	0.892	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.886	regulation of cellular biosynthetic process
GO:0010556	0.880	regulation of macromolecule biosynthetic process
GO:0050896	0.879	response to stimulus
GO:0051252	0.875	regulation of RNA metabolic process
GO:0006355	0.871	regulation of DNA-templated transcription
GO:0031325	0.868	positive regulation of cellular metabolic process
GO:0051173	0.866	positive regulation of nitrogen compound metabolic process
GO:0010604	0.857	positive regulation of macromolecule metabolic process
GO:0008152	0.779	metabolic process
GO:0010557	0.778	positive regulation of macromolecule biosynthetic process
GO:0031328	0.777	positive regulation of cellular biosynthetic process
GO:0045935	0.763	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.741	cellular response to stimulus
GO:0045893	0.673	positive regulation of DNA-templated transcription
GO:0044237	0.639	cellular metabolic process
GO:0006950	0.442	response to stress
GO:0071704	0.401	organic substance metabolic process
GO:0048519	0.387	negative regulation of biological process
GO:0044238	0.349	primary metabolic process
GO:0048523	0.309	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005654	0.977	nucleoplasm
GO:0032991	0.975	protein-containing complex
GO:0005694	0.879	chromosome
GO:0016020	0.787	membrane
GO:0140513	0.521	nuclear protein-containing complex
GO:0005737	0.510	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]