StarFunc result for job id Q9BQG2

User Input

>input (462 residues)
MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPE
IVQFLLEKGCDRSIVNKSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENY
FSKTLLDRKSEKRNNSDWLLAKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLN
YTDIKDYLAQPEKITLIFLGVELEIKDKLLNYAGEVPREEEDGLVAWFALGIDPIAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKR
LCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR
WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQG2	1.000	1.000	6.837E-99	462	1.000	1.000	Q9BQG2.pdb.gz	NUD12_HUMAN NAD-capped RNA hydrolase NUDT12 OS=Homo sapiens OX=9606 GN=NUDT12 PE=1 SV=1
2	AFDB:Q9DCN1	0.763	0.763	1.557E-88	462	0.879	0.879	Q9DCN1.pdb.gz	NUD12_MOUSE NAD-capped RNA hydrolase NUDT12 OS=Mus musculus OX=10090 GN=Nudt12 PE=1 SV=1
3	AFDB:Q9Y7J0	0.621	0.754	1.082E-33	376	0.277	0.340	Q9Y7J0.pdb.gz	NPY1_SCHPO NAD-capped RNA hydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1778.03c PE=3 SV=1
4	AFDB:Q5AU26	0.641	0.711	1.710E-33	415	0.279	0.311	Q5AU26.pdb.gz	Q5AU26_EMENI NAD(+) diphosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08204 PE=4 SV=1
5	AFDB:P53164	0.627	0.749	1.437E-29	384	0.219	0.263	P53164.pdb.gz	NPY1_YEAST NAD-capped RNA hydrolase NPY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPY1 PE=1 SV=1
6	AFDB:Q94A82	0.575	0.605	5.354E-29	438	0.266	0.281	Q94A82.pdb.gz	NUD19_ARATH Nudix hydrolase 19, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT19 PE=1 SV=1
7	AFDB:Q86X67	0.570	0.737	4.134E-27	352	0.242	0.318	Q86X67.pdb.gz	NUD13_HUMAN NAD(P)H pyrophosphatase NUDT13, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT13 PE=2 SV=3
8	AFDB:P9WIX5	0.553	0.800	1.631E-26	313	0.197	0.291	P9WIX5.pdb.gz	NUDC_MYCTU NAD-capped RNA hydrolase NudC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nudC PE=3 SV=1
9	AFDB:Q8JZU0	0.563	0.726	2.434E-26	352	0.234	0.307	Q8JZU0.pdb.gz	NUD13_MOUSE NAD(P)H pyrophosphatase NUDT13, mitochondrial OS=Mus musculus OX=10090 GN=Nudt13 PE=1 SV=2
10	AFDB:O86062	0.464	0.750	7.396E-20	278	0.171	0.284	O86062.pdb.gz	NUDC_PSEAE NAD-capped RNA hydrolase NudC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nudC PE=3 SV=2
11	PDB:2gb5A	0.394	0.666	3.745E-19	265	0.134	0.234	2gb5A.pdb.gz	Crystal structure of NADH pyrophosphatase (EC 3.6.1.22) (1790429) from Escherichia coli K12 at 2.30 A resolution
12	PDB:5otnA	0.200	0.528	4.229E-8	156	0.067	0.199	5otnA.pdb.gz	MutT homologue 1 (MTH1) catalyzes the hydrolysis of mutagenic O6-methyl-dGTP.
13	PDB:4zbpB	0.232	0.376	5.317E-8	270	0.071	0.122	4zbpB.pdb.gz	Crystal Structures of Arabidopsis thaliana Nudix Hydrolase NUDT7 Reveal a Previously Unobserved Conformation.
14	PDB:5gp0I	0.207	0.619	5.961E-8	139	0.071	0.237	5gp0I.pdb.gz	Structural Insights into the Substrate Recognition Mechanism of Arabidopsis GPP-Bound NUDX1 for Noncanonical Monoterpene Biosynthesis.
15	PDB:7b66A	0.213	0.569	5.961E-8	161	0.058	0.168	7b66A.pdb.gz	Crystal structures of NUDT15 variants enabled by a potent inhibitor reveal the structural basis for thiopurine sensitivity.
16	PDB:2rrkA	0.223	0.630	6.312E-8	140	0.054	0.179	2rrkA.pdb.gz
17	PDB:6aa3A	0.200	0.519	8.896E-8	162	0.065	0.185	6aa3A.pdb.gz	Discovery of a new class of MTH1 inhibitor by X-ray crystallographic screening.
18	PDB:1g9qA	0.241	0.508	1.118E-7	205	0.067	0.151	1g9qA.pdb.gz	The structure of ADP-ribose pyrophosphatase reveals the structural basis for the versatility of the Nudix family.
19	PDB:2fkbC	0.234	0.565	1.767E-7	167	0.065	0.180	2fkbC.pdb.gz
20	PDB:2b2kB	0.242	0.556	2.098E-7	180	0.063	0.161	2b2kB.pdb.gz	Structural role for Tyr-104 in Escherichia coli isopentenyl-diphosphate isomerase: site-directed mutagenesis, enzymology, and protein crystallography

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQG2	0.0	962	462	1.000	1.000	NUD12_HUMAN NAD-capped RNA hydrolase NUDT12 OS=Homo sapiens OX=9606 GN=NUDT12 PE=1 SV=1
2	Q9DCN1	0.0	868	462	0.879	0.879	NUD12_MOUSE NAD-capped RNA hydrolase NUDT12 OS=Mus musculus OX=10090 GN=Nudt12 PE=1 SV=1
3	Q5AU26	1.46e-57	197	415	0.294	0.328	Q5AU26_EMENI NAD(+) diphosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08204 PE=4 SV=1
4	Q9Y7J0	1.65e-56	193	376	0.286	0.351	NPY1_SCHPO NAD-capped RNA hydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1778.03c PE=3 SV=1
5	Q94A82	1.47e-48	174	438	0.260	0.274	NUD19_ARATH Nudix hydrolase 19, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT19 PE=1 SV=1
6	Q86X67	2.92e-47	168	352	0.238	0.312	NUD13_HUMAN NAD(P)H pyrophosphatase NUDT13, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT13 PE=2 SV=3
7	Q8JZU0	1.83e-42	155	352	0.240	0.315	NUD13_MOUSE NAD(P)H pyrophosphatase NUDT13, mitochondrial OS=Mus musculus OX=10090 GN=Nudt13 PE=1 SV=2
8	P53164	2.06e-39	148	384	0.240	0.289	NPY1_YEAST NAD-capped RNA hydrolase NPY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NPY1 PE=1 SV=1
9	P9WIX5	5.64e-30	120	313	0.180	0.265	NUDC_MYCTU NAD-capped RNA hydrolase NudC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nudC PE=3 SV=1
10	O86062	3.15e-23	101	278	0.158	0.263	NUDC_PSEAE NAD-capped RNA hydrolase NudC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nudC PE=3 SV=2
11	P32664	4.45e-23	100	257	0.162	0.292	NUDC_ECOLI NAD-capped RNA hydrolase NudC OS=Escherichia coli (strain K12) OX=83333 GN=nudC PE=1 SV=2
12	O14593	5.46e-09	59.3	260	0.071	0.127	RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens OX=9606 GN=RFXANK PE=1 SV=2
13	Q9H9E1	3.16e-08	57.4	313	0.065	0.096	ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens OX=9606 GN=ANKRA2 PE=1 SV=1
14	Q99PE2	3.37e-08	57.4	312	0.065	0.096	ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus OX=10090 GN=Ankra2 PE=1 SV=1
15	Q6NSI1	3.92e-08	57.0	321	0.063	0.090	AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens OX=9606 GN=ANKRD26P1 PE=5 SV=2
16	F5GY33	5.98e-07	52.0	188	0.058	0.144	F5GY33_HUMAN Regulatory factor X associated ankyrin containing protein (Fragment) OS=Homo sapiens OX=9606 GN=RFXANK PE=1 SV=2
17	J3QSU0	6.27e-07	53.5	332	0.065	0.090	J3QSU0_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1B (Fragment) OS=Homo sapiens OX=9606 GN=ANKS1B PE=1 SV=2
18	P0C6S7	8.08e-07	54.3	1260	0.065	0.024	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
19	Q7Z6G8	8.79e-07	53.9	1248	0.065	0.024	ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ANKS1B PE=1 SV=2
20	Q8BIZ1	9.44e-07	53.9	1259	0.065	0.024	ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus OX=10090 GN=Anks1b PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.2e-05	36.7	Ankyrin repeat
2	PF12796 Ank_2	5e-10	51.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.4e-05	35.2	Ankyrin repeat
4	PF13637 Ank_4	9.4e-07	40.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.9e-08	44.1	Ankyrin repeats (many copies)
6	PF03119 DNA_ligase_ZBD	3.7e+02	12.5	NAD-dependent DNA ligase C4 zinc finger domain
7	PF00293 NUDIX	8.6e-14	63.1	NUDIX domain
8	PF09296 NUDIX-like	0.00043	32.3	NADH pyrophosphatase-like rudimentary NUDIX domain
9	PF09297 zf-NADH-PPase	0.00025	32.0	NADH pyrophosphatase zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230792

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401508	0.949	Nicotinate phosphoribosyltransferase
2	9606.ENSP00000222553	0.946	Nicotinamide phosphoribosyltransferase
3	9606.ENSP00000326424	0.938	Glutamine-dependent NAD(+) synthetase
4	9606.ENSP00000354387	0.930	Nicotinamide riboside kinase 1
5	9606.ENSP00000249396	0.927	NAD-dependent protein deacetylase sirtuin-2
6	9606.ENSP00000257770	0.925	5'-nucleotidase
7	9606.ENSP00000339479	0.920	Cytosolic purine 5'-nucleotidase
8	9606.ENSP00000371362	0.917	NAD kinase 2, mitochondrial
9	9606.ENSP00000476228	0.916	NAD-dependent protein deacylase sirtuin-5, mitochondrial
10	9606.ENSP00000212015	0.914	NAD-dependent protein deacetylase sirtuin-1
11	9606.ENSP00000378782	0.914	Nicotinate-nucleotide pyrophosphorylase [carboxylating]
12	9606.ENSP00000372191	0.913	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
13	9606.ENSP00000202967	0.912	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
14	9606.ENSP00000329466	0.912	NAD-dependent protein deacetylase sirtuin-7
15	9606.ENSP00000337332	0.912	NAD-dependent protein deacetylase sirtuin-6
16	9606.ENSP00000480091	0.905	Nicotinamide riboside kinase 2
17	9606.ENSP00000235628	0.904	Cytosolic 5'-nucleotidase 1A
18	9606.ENSP00000265016	0.904	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
19	9606.ENSP00000264663	0.902	NAD(P) transhydrogenase, mitochondrial
20	9606.ENSP00000226279	0.900	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140098	0.999	catalytic activity, acting on RNA
GO:0016462	0.999	pyrophosphatase activity
GO:0016788	0.937	hydrolase activity, acting on ester bonds
GO:0004519	0.886	endonuclease activity
GO:0004521	0.877	RNA endonuclease activity
GO:0016893	0.872	endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters
GO:0016891	0.855	RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0043167	0.798	ion binding
GO:0046872	0.702	metal ion binding
GO:0000287	0.568	magnesium ion binding
GO:0000210	0.405	NAD+ diphosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044238	0.992	primary metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:1901360	0.987	organic cyclic compound metabolic process
GO:0046483	0.986	heterocycle metabolic process
GO:0006725	0.983	cellular aromatic compound metabolic process
GO:0034641	0.983	cellular nitrogen compound metabolic process
GO:0006139	0.974	nucleobase-containing compound metabolic process
GO:1901564	0.934	organonitrogen compound metabolic process
GO:0006163	0.919	purine nucleotide metabolic process
GO:0043170	0.909	macromolecule metabolic process
GO:0019674	0.877	NAD metabolic process
GO:0044248	0.875	cellular catabolic process
GO:1901575	0.873	organic substance catabolic process
GO:0046434	0.853	organophosphate catabolic process
GO:1901292	0.839	nucleoside phosphate catabolic process
GO:0009166	0.790	nucleotide catabolic process
GO:0110154	0.707	RNA decapping
GO:0072523	0.571	purine-containing compound catabolic process
GO:0018130	0.504	heterocycle biosynthetic process
GO:1901362	0.503	organic cyclic compound biosynthetic process
GO:0044271	0.485	cellular nitrogen compound biosynthetic process
GO:0034654	0.472	nucleobase-containing compound biosynthetic process
GO:0009165	0.455	nucleotide biosynthetic process
GO:0072525	0.442	pyridine-containing compound biosynthetic process
GO:0050789	0.441	regulation of biological process
GO:0006195	0.315	purine nucleotide catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.994	intracellular organelle lumen
GO:0005829	0.957	cytosol
GO:0031907	0.786	microbody lumen
GO:0005777	0.785	peroxisome
GO:0005782	0.656	peroxisomal matrix
GO:0031981	0.455	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.999	In phosphorus-containing anhydrides.
EC:3.1.-.-	0.937	Acting on ester bonds.
EC:3.1.30.-	0.872	Endoribonucleases active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters.
EC:3.1.26.-	0.855	Endoribonucleases producing 5'-phosphomonoesters.
RHEA:11800	0.405	H2O + NAD(+) = AMP + beta-nicotinamide D-ribonucleotide + 2 H(+)
EC:3.6.1.22	0.405	NAD(+) diphosphatase.

[back to server]