StarFunc result for job id Q9BQI3

User Input

>input (630 residues)
MQGGNSGVRKREEEGDGAGAVAAPPAIDFPAEGPDPEYDESDVPAEIQVLKEPLQQPTFP
FAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHH
NRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
VYKVRNKLDGQYYAIKKILIKGATKTVCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVI
QPRADRAAIELPSLEVLSDQEEDREQCGVKNDESSSSSIIFAEPTPEKEKRFGESDTENQ
NNKSVKYTTNLVIRESGELESTLELQENGLAGLSASSIVEQQLPLRRNSHLEESFTSTEE
SSEENVNFLGQTEAQYHLMLHIQMQLCELSLWDWIVERNKRGREYVDESACPYVMANVAT
KIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACTDILQKNTDWTNRN
GKRTPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSLGVVLLELFQPFGTEMERAEVLTGL
RTGQLPESLRKRCPVQAKYIQHLTRRNSSQRPSAIQLLQSELFQNSGNVNLTLQMKIIEQ
EKEIAELKKQLNLLSQDKGVRDDGKDGGVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQI3	1.000	1.000	4.638E-101	630	1.000	1.000	Q9BQI3.pdb.gz	E2AK1_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens OX=9606 GN=EIF2AK1 PE=1 SV=2
2	AFDB:Q63185	0.620	0.629	3.798E-78	620	0.810	0.823	Q63185.pdb.gz	E2AK1_RAT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Rattus norvegicus OX=10116 GN=Eif2ak1 PE=1 SV=2
3	AFDB:P33279	0.612	0.616	3.224E-76	626	0.822	0.827	P33279.pdb.gz	E2AK1_RABIT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Oryctolagus cuniculus OX=9986 GN=EIF2AK1 PE=1 SV=1
4	AFDB:O13889	0.417	0.376	1.946E-31	704	0.263	0.236	O13889.pdb.gz	E2AK1_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hri1 PE=1 SV=1
5	AFDB:B8JI14	0.421	0.248	1.071E-26	1099	0.219	0.126	B8JI14.pdb.gz	B8JI14_DANRE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Danio rerio OX=7955 GN=eif2ak3 PE=1 SV=1
6	AFDB:Q9NZJ5	0.409	0.237	1.734E-26	1116	0.221	0.125	Q9NZJ5.pdb.gz	E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens OX=9606 GN=EIF2AK3 PE=1 SV=3
7	AFDB:D4A7V9	0.414	0.168	3.476E-26	1649	0.227	0.087	D4A7V9.pdb.gz	E2AK4_RAT eIF-2-alpha kinase GCN2 OS=Rattus norvegicus OX=10116 GN=Eif2ak4 PE=3 SV=2
8	AFDB:Q9HGN1	0.394	0.164	1.128E-25	1576	0.221	0.088	Q9HGN1.pdb.gz	GCN2_SCHPO eIF-2-alpha kinase GCN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn2 PE=2 SV=2
9	AFDB:Q9Z2B5	0.406	0.236	1.640E-25	1114	0.224	0.127	Q9Z2B5.pdb.gz	E2AK3_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Mus musculus OX=10090 GN=Eif2ak3 PE=1 SV=1
10	AFDB:A0A0B4KHX7	0.397	0.162	7.339E-25	1591	0.208	0.082	A0A0B4KHX7.pdb.gz	A0A0B4KHX7_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Gcn2 PE=1 SV=1
11	PDB:7qwkH	0.366	0.862	1.753E-17	259	0.183	0.444	7qwkH.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
12	PDB:7qwkE	0.350	0.884	2.982E-15	241	0.168	0.440	7qwkE.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
13	PDB:4krcA	0.326	0.660	1.195E-12	297	0.127	0.269	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
14	PDB:1unlA	0.321	0.659	1.480E-12	292	0.119	0.257	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:4eomC	0.342	0.736	1.647E-12	276	0.114	0.261	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:4yc3A	0.338	0.687	1.327E-11	295	0.114	0.244	4yc3A.pdb.gz
17	PDB:5u6yA	0.336	0.448	1.830E-11	459	0.129	0.176	5u6yA.pdb.gz
18	PDB:7cgaA	0.334	0.586	2.267E-11	347	0.098	0.179	7cgaA.pdb.gz
19	PDB:1j1bB	0.336	0.560	3.125E-11	364	0.111	0.192	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.
20	PDB:3mi9A	0.335	0.617	5.630E-11	329	0.127	0.243	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P33279	0.0	994	626	0.824	0.829	E2AK1_RABIT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Oryctolagus cuniculus OX=9986 GN=EIF2AK1 PE=1 SV=1
2	Q63185	0.0	990	620	0.810	0.823	E2AK1_RAT Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Rattus norvegicus OX=10116 GN=Eif2ak1 PE=1 SV=2
3	Q9BQI3	0.0	1306	630	1.000	1.000	E2AK1_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Homo sapiens OX=9606 GN=EIF2AK1 PE=1 SV=2
4	Q9Z2R9	0.0	971	619	0.817	0.832	E2AK1_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Mus musculus OX=10090 GN=Eif2ak1 PE=1 SV=2
5	Q9UTE5	2.73e-58	209	639	0.281	0.277	E2AK2_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hri2 PE=1 SV=1
6	O13889	6.87e-52	192	704	0.252	0.226	E2AK1_SCHPO Eukaryotic translation initiation factor 2-alpha kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hri1 PE=1 SV=1
7	D4A7V9	5.89e-42	166	1649	0.237	0.090	E2AK4_RAT eIF-2-alpha kinase GCN2 OS=Rattus norvegicus OX=10116 GN=Eif2ak4 PE=3 SV=2
8	Q9P2K8	7.26e-42	165	1649	0.240	0.092	E2AK4_HUMAN eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4 PE=1 SV=3
9	Q9QZ05	1.70e-41	164	1648	0.233	0.089	E2AK4_MOUSE eIF-2-alpha kinase GCN2 OS=Mus musculus OX=10090 GN=Eif2ak4 PE=1 SV=2
10	Q4WU06	1.73e-39	158	1592	0.206	0.082	Q4WU06_ASPFU non-specific serine/threonine protein kinase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G06750 PE=4 SV=1
11	Q384V1	2.39e-34	142	1236	0.200	0.102	Q384V1_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5050 PE=4 SV=1
12	Q9NIV1	6.74e-33	137	1162	0.133	0.072	E2AK3_DROME Eukaryotic translation initiation factor 2-alpha kinase OS=Drosophila melanogaster OX=7227 GN=PEK PE=1 SV=2
13	Q9Z2B5	1.80e-32	136	1114	0.133	0.075	E2AK3_MOUSE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Mus musculus OX=10090 GN=Eif2ak3 PE=1 SV=1
14	B8JI14	2.33e-32	136	1099	0.132	0.076	B8JI14_DANRE Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Danio rerio OX=7955 GN=eif2ak3 PE=1 SV=1
15	Q9NZJ5	7.07e-32	134	1116	0.127	0.072	E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens OX=9606 GN=EIF2AK3 PE=1 SV=3
16	Q9Z1Z1	9.44e-32	134	1108	0.129	0.073	E2AK3_RAT Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Rattus norvegicus OX=10116 GN=Eif2ak3 PE=1 SV=1
17	Q5NE12	1.27e-30	128	511	0.132	0.162	Q5NE12_DANRE Z-DNA binding protein kinase OS=Danio rerio OX=7955 GN=pkz PE=1 SV=1
18	Q9HGN1	1.87e-30	130	1576	0.143	0.057	GCN2_SCHPO eIF-2-alpha kinase GCN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn2 PE=2 SV=2
19	Q5NE14	1.33e-28	122	511	0.130	0.160	Q5NE14_DANRE Interferon-induced, double-stranded RNA-activated protein kinase OS=Danio rerio OX=7955 GN=zgc:136657 PE=1 SV=1
20	F4J8A5	8.67e-27	119	1265	0.122	0.061	F4J8A5_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=GCN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	82	14.5	Phosphotransferase enzyme family
2	PF13095 FTA2	69	14.6	Kinetochore Sim4 complex subunit FTA2
3	PF06293 Kdo	73	14.2	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	3.7e-43	159.4	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	8.6e-23	92.5	Protein tyrosine and serine/threonine kinase
6	PF04102 SlyX	9.5e+02	11.8	SlyX

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000199389

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256383	0.996	Eukaryotic translation initiation factor 2 subunit 1
2	9606.ENSP00000253039	0.958	Eukaryotic translation initiation factor 2 subunit 3
3	9606.ENSP00000364119	0.956	Eukaryotic translation initiation factor 2 subunit 2
4	9606.ENSP00000336762	0.895	Angiogenin
5	9606.ENSP00000336790	0.890	Cyclic AMP-dependent transcription factor ATF-4
6	9606.ENSP00000200453	0.880	Protein phosphatase 1 regulatory subunit 15A
7	9606.ENSP00000380252	0.819	Nuclear factor erythroid 2-related factor 2
8	9606.ENSP00000396954	0.817	Cyclic AMP-dependent transcription factor ATF-5
9	9606.ENSP00000355890	0.809	Bifunctional glutamate/proline--tRNA ligase
10	9606.ENSP00000360869	0.804	Interferon-induced protein with tetratricopeptide repeats 1
11	9606.ENSP00000360874	0.804	Interferon induced protein with tetratricopeptide repeats 1B
12	9606.ENSP00000448665	0.804	DNA damage-inducible transcript 3 protein
13	9606.ENSP00000362576	0.759	Tyrosine--tRNA ligase, cytoplasmic
14	9606.ENSP00000325448	0.712	Lysine--tRNA ligase
15	9606.ENSP00000381057	0.699	Ribonuclease pancreatic
16	9606.ENSP00000416250	0.698	Translation initiation factor eIF-2B subunit alpha
17	9606.ENSP00000467723	0.697	Zinc finger protein 699
18	9606.ENSP00000300648	0.674	eIF-2-alpha kinase activator GCN1
19	9606.ENSP00000266126	0.660	Translation initiation factor eIF-2B subunit beta
20	9606.ENSP00000425634	0.649	Histidine--tRNA ligase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004694	0.999	eukaryotic translation initiation factor 2alpha kinase activity
GO:0097159	0.386	organic cyclic compound binding
GO:1901363	0.381	heterocyclic compound binding
GO:0003676	0.316	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.976	biological regulation
GO:0050896	0.972	response to stimulus
GO:0050794	0.968	regulation of cellular process
GO:0044237	0.947	cellular metabolic process
GO:0071704	0.946	organic substance metabolic process
GO:0044238	0.944	primary metabolic process
GO:0006807	0.937	nitrogen compound metabolic process
GO:0006950	0.919	response to stress
GO:0051716	0.899	cellular response to stimulus
GO:0043170	0.888	macromolecule metabolic process
GO:1901564	0.873	organonitrogen compound metabolic process
GO:0019538	0.816	protein metabolic process
GO:0033554	0.793	cellular response to stress
GO:0019222	0.755	regulation of metabolic process
GO:0080090	0.711	regulation of primary metabolic process
GO:0060255	0.711	regulation of macromolecule metabolic process
GO:0031323	0.626	regulation of cellular metabolic process
GO:0051171	0.612	regulation of nitrogen compound metabolic process
GO:0010468	0.508	regulation of gene expression
GO:0009889	0.497	regulation of biosynthetic process
GO:0010556	0.491	regulation of macromolecule biosynthetic process
GO:0016310	0.487	phosphorylation
GO:0031326	0.487	regulation of cellular biosynthetic process
GO:0006468	0.448	protein phosphorylation
GO:0009605	0.413	response to external stimulus
GO:0048519	0.388	negative regulation of biological process
GO:0048518	0.335	positive regulation of biological process
GO:0051246	0.329	regulation of protein metabolic process
GO:0007154	0.313	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.322	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]