StarFunc result for job id Q9BQI4

User Input

>input (270 residues)
MLRQLLLAALCLAGPPAPARACQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYN
HLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSY
FFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQE
DSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLEL
ANQKLSEKLAAGALPHINARGPVRPPYLRG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D6Y1	0.813	0.805	7.141E-37	273	0.896	0.886	Q9D6Y1.pdb.gz	CCDC3_MOUSE Coiled-coil domain-containing protein 3 OS=Mus musculus OX=10090 GN=Ccdc3 PE=1 SV=1
2	AFDB:Q5EBX5	0.303	0.099	7.800E-5	961	0.100	0.028	Q5EBX5.pdb.gz	Q5EBX5_MOUSE Mini-agrin OS=Mus musculus OX=10090 GN=Agrn PE=2 SV=1
3	AFDB:P81556	0.300	0.350	1.049E-4	224	0.070	0.085	P81556.pdb.gz	TIMP4_RAT Metalloproteinase inhibitor 4 OS=Rattus norvegicus OX=10116 GN=Timp4 PE=2 SV=2
4	AFDB:Q32N13	0.277	0.241	3.234E-4	319	0.081	0.069	Q32N13.pdb.gz	Q32N13_XENLA Secreted frizzled-related protein 3 OS=Xenopus laevis OX=8355 GN=frzb.S PE=2 SV=1
5	AFDB:Q9JI33	0.298	0.139	7.412E-4	628	0.067	0.029	Q9JI33.pdb.gz	NET4_MOUSE Netrin-4 OS=Mus musculus OX=10090 GN=Ntn4 PE=1 SV=2
6	AFDB:Q9HB63	0.298	0.140	1.699E-3	628	0.052	0.022	Q9HB63.pdb.gz	NET4_HUMAN Netrin-4 OS=Homo sapiens OX=9606 GN=NTN4 PE=1 SV=2
7	AFDB:Q1MTE8	0.300	0.352	4.653E-3	220	0.081	0.100	Q1MTE8.pdb.gz
8	AFDB:P16035	0.276	0.322	5.558E-3	220	0.078	0.095	P16035.pdb.gz	TIMP2_HUMAN Metalloproteinase inhibitor 2 OS=Homo sapiens OX=9606 GN=TIMP2 PE=1 SV=2
9	AFDB:A0A0B5JPZ7	0.273	0.134	1.066E-2	603	0.056	0.025	A0A0B5JPZ7.pdb.gz
10	PDB:1ueaB	0.272	0.377	1.259E-2	181	0.059	0.088	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
11	AFDB:Q9BW85	0.172	0.149	1.615E-2	323	0.130	0.108	Q9BW85.pdb.gz	YJU2_HUMAN Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1
12	PDB:4btsA0	0.201	0.445	2.416E-2	99	0.063	0.172	4btsA0.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
13	PDB:7a5fJ6	0.170	0.357	4.636E-2	108	0.074	0.185	7a5fJ6.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
14	PDB:7uy5I	0.183	0.105	5.219E-2	528	0.093	0.047	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
15	PDB:3jd5L	0.181	0.389	7.019E-2	109	0.067	0.165	3jd5L.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
16	PDB:3j9wAL	0.182	0.316	7.902E-2	137	0.070	0.139	3j9wAL.pdb.gz	Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling.
17	PDB:4a2iL	0.197	0.388	7.902E-2	123	0.037	0.081	4a2iL.pdb.gz	Cryo-Electron Microscopy Structure of the 30S Subunit in Complex with the Yjeq Biogenesis Factor.
18	PDB:6zxgj	0.202	0.406	8.384E-2	116	0.078	0.181	6zxgj.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
19	PDB:1gxdC	0.267	0.355	8.896E-2	192	0.059	0.083	1gxdC.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
20	PDB:7u5cE	0.211	0.065	1.002E-1	1147	0.048	0.011	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQI4	0.0	561	270	1.000	1.000	CCDC3_HUMAN Coiled-coil domain-containing protein 3 OS=Homo sapiens OX=9606 GN=CCDC3 PE=2 SV=1
2	Q9D6Y1	7.44e-174	482	273	0.859	0.850	CCDC3_MOUSE Coiled-coil domain-containing protein 3 OS=Mus musculus OX=10090 GN=Ccdc3 PE=1 SV=1
3	O14157	0.39	34.7	2104	0.070	0.009	MYO3_SCHPO Myosin type-2 heavy chain 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo3 PE=1 SV=1
4	Q9C099	0.97	33.5	1032	0.070	0.018	LRCC1_HUMAN Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRCC1 PE=1 SV=2
5	O70156	1.7	32.3	364	0.100	0.074	OLR1_RAT Oxidized low-density lipoprotein receptor 1 OS=Rattus norvegicus OX=10116 GN=Olr1 PE=2 SV=1
6	D4A0T9	1.8	32.7	1425	0.081	0.015	D4A0T9_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 13 OS=Rattus norvegicus OX=10116 GN=Adamts13 PE=4 SV=3
7	M0R609	1.8	32.7	1020	0.081	0.022	M0R609_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 13 OS=Rattus norvegicus OX=10116 GN=Adamts13 PE=4 SV=3
8	Q388V4	2.0	32.3	971	0.056	0.015	Q388V4_TRYB2 Kinesin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0600 PE=4 SV=1
9	Q86VP1	2.9	32.0	789	0.100	0.034	TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2
10	Q8N2N9	3.0	32.0	1353	0.078	0.016	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
11	Q18237	3.1	32.0	1076	0.059	0.015	SMC5_CAEEL Structural maintenance of chromosomes protein 5 OS=Caenorhabditis elegans OX=6239 GN=smc-5 PE=1 SV=2
12	P54697	3.6	31.6	2245	0.067	0.008	MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoJ PE=3 SV=2
13	A0A087WX34	3.7	31.6	1269	0.052	0.011	A0A087WX34_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
14	F1LMV6	3.7	31.6	2877	0.056	0.005	DESP_RAT Desmoplakin OS=Rattus norvegicus OX=10116 GN=Dsp PE=1 SV=1
15	H3BS47	3.7	31.6	1253	0.052	0.011	H3BS47_HUMAN RPGRIP1 like OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=1
16	P15924	3.7	31.6	2871	0.048	0.005	DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3
17	Q68CZ1	3.7	31.6	1315	0.052	0.011	FTM_HUMAN Protein fantom OS=Homo sapiens OX=9606 GN=RPGRIP1L PE=1 SV=2
18	Q8IDZ6	3.9	31.6	1838	0.085	0.013	Q8IDZ6_PLAF7 Ubiquitin-activating enzyme OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1333200 PE=3 SV=1
19	Q96Q89	4.1	31.6	1820	0.070	0.010	KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3
20	E9Q557	4.2	31.6	2883	0.048	0.005	DESP_MOUSE Desmoplakin OS=Mus musculus OX=10090 GN=Dsp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05549 Allexi_40kDa	82	14.2	Allexivirus 40kDa protein
2	PF08614 ATG16	59	15.3	Autophagy protein 16 (ATG16)
3	PF10211 Ax_dynein_light	60	15.0	Axonemal dynein light chain
4	PF10046 BLOC1_2	1.9e+02	13.8	Biogenesis of lysosome-related organelles complex-1 subunit 2
5	PF05667 CCDC22	26	15.1	Coiled-coil domain-containing protein 22
6	PF19220 Crescentin	2.5e+02	12.1	Crescentin protein
7	PF05384 DegS	26	15.7	Sensor protein DegS
8	PF04977 DivIC	3e+02	12.6	Septum formation initiator
9	PF15855 DUF4726	4.4e+02	12.5	Domain of unknown function (DUF4726)
10	PF04356 DUF489	15	17.0	Protein of unknown function (DUF489)
11	PF01105 EMP24_GP25L	4.2e+02	12.3	emp24/gp25L/p24 family/GOLD
12	PF08702 Fib_alpha	34	16.0	Fibrinogen alpha/beta chain family
13	PF05377 FlaC_arch	78	15.1	Flagella accessory protein C (FlaC)
14	PF14661 HAUS6_N	5.2e+02	11.6	HAUS augmin-like complex subunit 6 N-terminus
15	PF01763 Herpes_UL6	1.8e+02	12.1	Herpesvirus UL6 like
16	PF10205 KLRAQ	3.2	19.4	Predicted coiled-coil domain-containing protein
17	PF08336 P4Ha_N	83	14.5	Prolyl 4-Hydroxylase alpha-subunit, N-terminal region
18	PF05478 Prominin	8.5e+02	9.3	Prominin
19	PF14992 TMCO5	53	14.8	TMCO5 family
20	PF06156 YabA	29	16.7	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368102

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364140	0.669	Collagen alpha-1(XV) chain
2	9606.ENSP00000281141	0.650	Cell division cycle protein 123 homolog
3	9606.ENSP00000312126	0.602	Adenylate cyclase type 4
4	9606.ENSP00000346537	0.584	SPARC-related modular calcium-binding protein 2
5	9606.ENSP00000367893	0.553	Selenide, water dikinase 1
6	9606.ENSP00000299295	0.540	Chondrolectin
7	9606.ENSP00000263038	0.532	Phytanoyl-CoA dioxygenase, peroxisomal
8	9606.ENSP00000376443	0.530	ATP-binding cassette sub-family A member 5
9	9606.ENSP00000266719	0.526	Keratocan
10	9606.ENSP00000436047	0.515	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
11	9606.ENSP00000353734	0.505	Zinc finger protein PLAGL1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.994	molecular function regulator activity
GO:0005102	0.984	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.987	regulation of cellular process
GO:0019216	0.962	regulation of lipid metabolic process
GO:0045833	0.937	negative regulation of lipid metabolic process
GO:0048583	0.914	regulation of response to stimulus
GO:0060255	0.913	regulation of macromolecule metabolic process
GO:0060759	0.855	regulation of response to cytokine stimulus
GO:0048523	0.847	negative regulation of cellular process
GO:0023051	0.832	regulation of signaling
GO:0001959	0.817	regulation of cytokine-mediated signaling pathway
GO:0010468	0.810	regulation of gene expression
GO:0010803	0.809	regulation of tumor necrosis factor-mediated signaling pathway
GO:0044238	0.762	primary metabolic process
GO:0071704	0.757	organic substance metabolic process
GO:0010629	0.743	negative regulation of gene expression
GO:0048585	0.676	negative regulation of response to stimulus
GO:0048518	0.674	positive regulation of biological process
GO:0060761	0.671	negative regulation of response to cytokine stimulus
GO:0001960	0.655	negative regulation of cytokine-mediated signaling pathway
GO:0048522	0.623	positive regulation of cellular process
GO:0009987	0.514	cellular process
GO:0044237	0.388	cellular metabolic process
GO:0009893	0.323	positive regulation of metabolic process
GO:0050793	0.309	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0012505	0.997	endomembrane system
GO:0005737	0.994	cytoplasm
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005783	0.644	endoplasmic reticulum
GO:0070013	0.306	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]