StarFunc result for job id Q9BQI6

User Input

>input (1058 residues)
MEDGTPKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
CAAGKWILTKDYIIHSAKSGRWLDETTYEWGYKIEKDSRYSPQMQSAPKRWREELKRTGA
PGAFHRWKVVLLVRTDKRSDSLIRVLEAGKANVILPKSSPSGITHVIASNARIKAEKEKD
NFKAPFYPIQYLGDFLLEKEIQNDEDSQTNSVWTEHSNEETNKDFRKDAGFLEMKGALRE
TMYRTQKEMQNHEDVNVGSILIQHHKKEKFSGSSKDLKFVKMRNTFGSHTYENQKEIKKK
DEDIQRSYTLRRKRKKGKESNCKKGVEHEKIKSTLRRHIYNRDQKEMKNSIFAEYAKESK
AMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESL
IEGHFFKEAIEELSTLQAHYIPPVCVLHALLENVLQDNIDTFSGRYFHILSALLHLHPPW
KSPAMSRYYLELFQCPTCMKGAWSLVEVLIRSCLFNESFCHQISENIGSKVLHLTLLKFF
FNLIESEVQHLSQKLYDWSDSQNLKITGKAMLLEIFWSGSETSGLLTKPVNMLLEWTIYS
HKEKFKSNDVFKHELAYLLAGILGAAIDYWIFLGLKMGRNVMRHMSDDLGSYVSLSCDDF
SSQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGV
LGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLPELLDLNLAKCSSSLKKLKKKS
EGELSCSKENCPSVVKKMNFHKTNLKGETALHRACINNQVEKLILLLSLPGIDINVKDNA
GWTPLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGP
VLLQQRNAKGELPLDYVVSPQIKEELFAITKIEDTVENFHAQAEKHFHYQQLEFGSFLLS
RMLLNFCSIFDLSSEFILASKGLTHLNELLMACKSHKETTSVHTDWLLDLYAGNIKTLQK
LPHILKELPENLKVCPGVHTEALMITLEMMCRSVMEFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R3P9	0.742	0.745	0.000	1054	0.787	0.790	Q8R3P9.pdb.gz	SLF1_MOUSE SMC5-SMC6 complex localization factor protein 1 OS=Mus musculus OX=10090 GN=Slf1 PE=1 SV=3
2	AFDB:Q9BQI6	1.000	1.000	0.000	1058	1.000	1.000	Q9BQI6.pdb.gz	SLF1_HUMAN SMC5-SMC6 complex localization factor protein 1 OS=Homo sapiens OX=9606 GN=SLF1 PE=1 SV=2
3	AFDB:Q6ZQF0	0.174	0.123	7.891E-9	1515	0.052	0.036	Q6ZQF0.pdb.gz	TOPB1_MOUSE DNA topoisomerase 2-binding protein 1 OS=Mus musculus OX=10090 GN=Topbp1 PE=1 SV=2
4	AFDB:Q9VY97	0.167	0.125	6.142E-7	1425	0.060	0.045	Q9VY97.pdb.gz	Q9VY97_DROME Mutagen-sensitive 101 OS=Drosophila melanogaster OX=7227 GN=mus101 PE=1 SV=1
5	AFDB:A0A2R8RVN3	0.168	0.118	1.252E-6	1526	0.058	0.040	A0A2R8RVN3.pdb.gz	A0A2R8RVN3_DANRE DNA topoisomerase 2-binding protein 1 OS=Danio rerio OX=7955 GN=topbp1 PE=1 SV=1
6	AFDB:Q90X95	0.129	0.173	2.992E-6	772	0.071	0.097	Q90X95.pdb.gz	Q90X95_XENLA BRCA1 associated RING domain 1 L homeolog OS=Xenopus laevis OX=8355 GN=bard1.L PE=1 SV=1
7	AFDB:O70445	0.127	0.173	4.812E-6	765	0.065	0.090	O70445.pdb.gz	BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus OX=10090 GN=Bard1 PE=2 SV=1
8	AFDB:A0AVN2	0.127	0.170	1.708E-5	777	0.065	0.089	A0AVN2.pdb.gz	A0AVN2_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
9	AFDB:Q9QZH2	0.131	0.176	3.093E-5	768	0.064	0.089	Q9QZH2.pdb.gz	BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus OX=10116 GN=Bard1 PE=2 SV=1
10	AFDB:A0A0R4IKD5	0.099	0.101	3.218E-5	1012	0.073	0.076	A0A0R4IKD5.pdb.gz
11	PDB:8cs9A	0.121	0.159	4.548E-5	796	0.100	0.133	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:5vkqA	0.114	0.083	5.293E-4	1499	0.099	0.070	5vkqA.pdb.gz
13	PDB:3ehqA	0.105	0.571	8.856E-4	182	0.032	0.187	3ehqA.pdb.gz
14	PDB:6v9hC	0.112	0.404	2.904E-3	270	0.050	0.196	6v9hC.pdb.gz
15	PDB:7lsyY	0.071	0.087	2.904E-3	855	0.027	0.034	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
16	PDB:1wg0A	0.119	0.483	3.021E-3	243	0.034	0.148	1wg0A.pdb.gz
17	PDB:6jd6B	0.116	0.585	3.143E-3	192	0.036	0.198	6jd6B.pdb.gz
18	PDB:4oauC	0.109	0.164	5.471E-3	692	0.050	0.077	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
19	PDB:7df7B	0.101	0.829	5.922E-3	119	0.026	0.235	7df7B.pdb.gz
20	PDB:1bd8A	0.103	0.586	1.208E-2	156	0.028	0.192	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R3P9	0.0	1702	1054	0.794	0.797	SLF1_MOUSE SMC5-SMC6 complex localization factor protein 1 OS=Mus musculus OX=10090 GN=Slf1 PE=1 SV=3
2	Q9BQI6	0.0	2192	1058	1.000	1.000	SLF1_HUMAN SMC5-SMC6 complex localization factor protein 1 OS=Homo sapiens OX=9606 GN=SLF1 PE=1 SV=2
3	Q59GC3	7.13e-23	105	439	0.060	0.144	Q59GC3_HUMAN Ankyrin repeat domain 11 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
4	E9Q4F7	3.00e-22	106	2643	0.060	0.024	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
5	Q6UB99	3.00e-22	106	2663	0.060	0.024	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
6	Q6PG48	4.03e-22	100	330	0.058	0.185	Q6PG48_HUMAN ANKRD12 protein OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=1
7	Q90X95	1.07e-20	100	772	0.061	0.084	Q90X95_XENLA BRCA1 associated RING domain 1 L homeolog OS=Xenopus laevis OX=8355 GN=bard1.L PE=1 SV=1
8	Q6UB98	1.27e-20	101	2062	0.055	0.028	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
9	Q96HA7	1.66e-18	94.0	1378	0.051	0.039	TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens OX=9606 GN=TONSL PE=1 SV=2
10	Q9QZH2	5.42e-18	92.0	768	0.059	0.081	BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus OX=10116 GN=Bard1 PE=2 SV=1
11	Q99728	3.62e-17	89.4	777	0.057	0.077	BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
12	O70445	6.28e-17	88.6	765	0.057	0.078	BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus OX=10090 GN=Bard1 PE=2 SV=1
13	A0AVN2	9.30e-17	87.8	777	0.056	0.076	A0AVN2_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
14	X5D778	1.15e-16	85.9	421	0.061	0.154	X5D778_HUMAN Ankyrin repeat domain 11 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=1
15	Q20129	2.20e-15	84.0	1182	0.064	0.058	Q20129_CAEEL BRCT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mus-101 PE=1 SV=3
16	A0A140LI88	9.35e-15	82.0	1857	0.049	0.028	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
17	Q9VY97	1.01e-14	81.6	1425	0.050	0.037	Q9VY97_DROME Mutagen-sensitive 101 OS=Drosophila melanogaster OX=7227 GN=mus101 PE=1 SV=1
18	Q7YU37	1.08e-14	81.6	1425	0.050	0.037	Q7YU37_DROME RE28166p OS=Drosophila melanogaster OX=7227 GN=mus101 PE=2 SV=1
19	Q2XXV4	1.12e-14	81.6	1412	0.050	0.038	Q2XXV4_DROME CG11156 (Fragment) OS=Drosophila melanogaster OX=7227 GN=mus101 PE=4 SV=1
20	Q9GTU6	1.18e-14	81.6	1425	0.050	0.037	Q9GTU6_DROME BRCT-domain protein MUS101 OS=Drosophila melanogaster OX=7227 GN=mus101 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.4e-10	51.6	Ankyrin repeat
2	PF12796 Ank_2	3.1e-13	61.4	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.1e-12	56.9	Ankyrin repeat
4	PF13637 Ank_4	1.3e-10	52.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.9e-12	58.4	Ankyrin repeats (many copies)
6	PF00533 BRCT	1.9	20.2	BRCA1 C Terminus (BRCT) domain
7	PF16759 LIG3_BRCT	1.2e+02	14.4	DNA ligase 3 BRCT domain
8	PF16770 RTT107_BRCT_5	8.5e-07	40.1	Regulator of Ty1 transposition protein 107 BRCT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359292	0.964	SMC5-SMC6 complex localization factor protein 2
2	9606.ENSP00000264926	0.963	E3 ubiquitin-protein ligase RAD18
3	9606.ENSP00000371475	0.917	TP53-binding protein 1
4	9606.ENSP00000405726	0.880	Cell division control protein 45 homolog
5	9606.ENSP00000343741	0.871	Serine/threonine-protein kinase ATR
6	9606.ENSP00000216367	0.858	DNA polymerase epsilon subunit 2
7	9606.ENSP00000384048	0.802	PAX-interacting protein 1
8	9606.ENSP00000365588	0.773	Mediator of DNA damage checkpoint protein 1
9	9606.ENSP00000418268	0.770	Protein MCM10 homolog
10	9606.ENSP00000393139	0.757	Cell division cycle 7-related protein kinase
11	9606.ENSP00000379294	0.741	Protein FAM172A
12	9606.ENSP00000323663	0.726	Protein DBF4 homolog B
13	9606.ENSP00000262105	0.714	DNA replication licensing factor MCM4
14	9606.ENSP00000372023	0.709	Serine/threonine-protein kinase Chk2
15	9606.ENSP00000262460	0.702	DNA replication complex GINS protein PSF1
16	9606.ENSP00000401018	0.691	GINS complex subunit 3
17	9606.ENSP00000322570	0.688	DNA polymerase epsilon catalytic subunit A
18	9606.ENSP00000388648	0.682	Serine/threonine-protein kinase Chk1
19	9606.ENSP00000404092	0.682	Structural maintenance of chromosomes protein 6
20	9606.ENSP00000426191	0.678	Cell cycle checkpoint protein RAD17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0031625	1.000	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050896	0.985	response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.982	regulation of metabolic process
GO:0048518	0.977	positive regulation of biological process
GO:0051716	0.970	cellular response to stimulus
GO:0051171	0.969	regulation of nitrogen compound metabolic process
GO:0048522	0.967	positive regulation of cellular process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0080090	0.948	regulation of primary metabolic process
GO:0031323	0.947	regulation of cellular metabolic process
GO:0033554	0.945	cellular response to stress
GO:0006974	0.943	cellular response to DNA damage stimulus
GO:0051173	0.936	positive regulation of nitrogen compound metabolic process
GO:0051052	0.935	regulation of DNA metabolic process
GO:0010604	0.931	positive regulation of macromolecule metabolic process
GO:0031325	0.931	positive regulation of cellular metabolic process
GO:0051054	0.868	positive regulation of DNA metabolic process
GO:2001020	0.803	regulation of response to DNA damage stimulus
GO:0048584	0.773	positive regulation of response to stimulus
GO:2001022	0.759	positive regulation of response to DNA damage stimulus
GO:0051179	0.741	localization
GO:0006282	0.709	regulation of DNA repair
GO:0034502	0.702	protein localization to chromosome
GO:2000779	0.702	regulation of double-strand break repair
GO:0045739	0.580	positive regulation of DNA repair
GO:0033043	0.578	regulation of organelle organization
GO:0051726	0.562	regulation of cell cycle
GO:0010564	0.488	regulation of cell cycle process
GO:0071704	0.398	organic substance metabolic process
GO:0044238	0.365	primary metabolic process
GO:0044237	0.353	cellular metabolic process
GO:0051130	0.349	positive regulation of cellular component organization
GO:0006807	0.344	nitrogen compound metabolic process
GO:0033044	0.340	regulation of chromosome organization
GO:0043170	0.334	macromolecule metabolic process
GO:0010638	0.325	positive regulation of organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0005654	0.999	nucleoplasm
GO:0032991	0.746	protein-containing complex
GO:0090734	0.740	site of DNA damage
GO:0005737	0.686	cytoplasm
GO:0035861	0.623	site of double-strand break

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]