StarFunc result for job id Q9BQI9

User Input

>input (281 residues)
MLFIFPLSLPWRPSCWKESCSTGQRQAGRSREDSVTPPPSSPWPTPPAGAMSTKQEARRD
EGEARTRGQEAQLRDRAHLSQQRRLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPRSVI
QRRLVEGNPNWLQGEPPRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRVAVDTGTQ
YNRISAGCLSRLGLEKRVLKASAGDLAPGPPTQVEQLELQLGQETVVCSAQVVDAESPEF
CLGLQTLLSLKCCIDLEHGVLRLKAPFSELPFLPLYQEPGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQI9	1.000	1.000	1.316E-50	281	1.000	1.000	Q9BQI9.pdb.gz	NRIP2_HUMAN Nuclear receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=NRIP2 PE=1 SV=3
2	AFDB:Q9JHR9	0.372	0.386	9.111E-26	270	0.594	0.619	Q9JHR9.pdb.gz	NRIP2_MOUSE Nuclear receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Nrip2 PE=1 SV=2
3	AFDB:Q9NQ35	0.407	0.471	6.161E-21	241	0.324	0.378	Q9NQ35.pdb.gz	NRIP3_HUMAN Nuclear receptor-interacting protein 3 OS=Homo sapiens OX=9606 GN=NRIP3 PE=1 SV=1
4	AFDB:Q8WTU0	0.378	0.274	6.500E-12	396	0.206	0.146	Q8WTU0.pdb.gz	DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens OX=9606 GN=DDI1 PE=1 SV=1
5	PDB:2avoA	0.264	0.670	6.269E-5	99	0.075	0.212	2avoA.pdb.gz	Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S.
6	PDB:3qvcA	0.241	0.193	1.108E-3	368	0.050	0.038	3qvcA.pdb.gz
7	PDB:2bjuA	0.231	0.204	1.699E-3	329	0.057	0.049	2bjuA.pdb.gz	X-Ray Structure of Plasmepsin II Complexed with a Potent Achiral Inhibitor.
8	PDB:4amtA	0.183	0.155	2.307E-3	349	0.082	0.066	4amtA.pdb.gz
9	PDB:5mktA	0.207	0.181	2.771E-3	329	0.060	0.052	5mktA.pdb.gz
10	PDB:3aupA	0.182	0.145	4.077E-2	377	0.060	0.045	3aupA.pdb.gz
11	PDB:1tzsA	0.212	0.191	4.607E-2	322	0.075	0.065	1tzsA.pdb.gz	Crystal structure of an activation intermediate of cathepsin e
12	PDB:5ux4B	0.217	0.186	5.882E-2	340	0.053	0.044	5ux4B.pdb.gz	Development of 2-aminooxazoline 3-azaxanthene beta-amyloid cleaving enzyme (BACE) inhibitors with improved selectivity against Cathepsin D.
13	PDB:2qzwA	0.230	0.197	1.384E-1	341	0.071	0.059	2qzwA.pdb.gz
14	AFDB:D4A6Q4	0.121	0.049	2.523E-1	766	0.142	0.052	D4A6Q4.pdb.gz	D4A6Q4_RAT Erythrocyte membrane protein band 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=3
15	AFDB:Q2QLR0	0.106	0.094	3.641E-1	338	0.142	0.118	Q2QLR0.pdb.gz	Q2QLR0_ORYSJ Helix-loop-helix DNA-binding domain containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os12g43620 PE=3 SV=1
16	PDB:4rerA	0.099	0.065	4.157E-1	459	0.082	0.050	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	AFDB:Q9UBF9	0.127	0.083	4.373E-1	498	0.117	0.066	Q9UBF9.pdb.gz	MYOTI_HUMAN Myotilin OS=Homo sapiens OX=9606 GN=MYOT PE=1 SV=2
18	AFDB:A0A024QZW2	0.102	0.110	5.584E-1	257	0.100	0.109	A0A024QZW2.pdb.gz
19	AFDB:O81037	0.094	0.075	6.708E-1	371	0.139	0.105	O81037.pdb.gz	BH070_ARATH Transcription factor bHLH70 OS=Arabidopsis thaliana OX=3702 GN=BHLH70 PE=2 SV=1
20	AFDB:P42698	0.111	0.091	7.580E-1	387	0.103	0.075	P42698.pdb.gz	DR111_ARATH DNA-damage-repair/toleration protein DRT111, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DRT111 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQI9	0.0	565	281	1.000	1.000	NRIP2_HUMAN Nuclear receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=NRIP2 PE=1 SV=3
2	Q9JHR9	6.59e-106	310	270	0.580	0.604	NRIP2_MOUSE Nuclear receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Nrip2 PE=1 SV=2
3	Q9NQ35	2.77e-43	149	241	0.327	0.382	NRIP3_HUMAN Nuclear receptor-interacting protein 3 OS=Homo sapiens OX=9606 GN=NRIP3 PE=1 SV=1
4	Q8WTU0	6.97e-08	55.5	396	0.132	0.093	DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens OX=9606 GN=DDI1 PE=1 SV=1
5	Q5TDH0	8.03e-08	55.1	399	0.132	0.093	DDI2_HUMAN Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1
6	Q10256	1.02e-07	54.7	332	0.132	0.111	MUD1_SCHPO UBA domain-containing protein Mud1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mud1 PE=1 SV=1
7	Q1EBV4	1.04e-05	48.5	414	0.132	0.089	DDI1_ARATH Protein DNA-DAMAGE INDUCIBLE 1 OS=Arabidopsis thaliana OX=3702 GN=DDI1 PE=1 SV=1
8	P40087	1.06e-05	48.5	428	0.110	0.072	DDI1_YEAST DNA damage-inducible protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DDI1 PE=1 SV=1
9	Q9VXF9	3.29e-05	47.4	458	0.121	0.074	Q9VXF9_DROME AT13091p OS=Drosophila melanogaster OX=7227 GN=rngo PE=1 SV=1
10	Q17569	0.14	35.8	389	0.114	0.082	DDI1_CAEEL Protein DDI1 homolog 1 OS=Caenorhabditis elegans OX=6239 GN=ddi-1 PE=1 SV=2
11	Q38FA2	0.23	35.0	378	0.110	0.082	Q38FA2_TRYB2 DNA-damage inducible protein DDI1-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2990 PE=3 SV=1
12	B2ZX90	7.2	30.8	940	0.053	0.016	FAS1_ORYSJ Chromatin assembly factor 1 subunit FSM OS=Oryza sativa subsp. japonica OX=39947 GN=FSM PE=2 SV=1
13	Q09PK2	8.9	30.0	339	0.093	0.077	APRV1_MOUSE Retroviral-like aspartic protease 1 OS=Mus musculus OX=10090 GN=Asprv1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09668 Asp_protease	0.002	29.3	Aspartyl protease
2	PF13650 Asp_protease_2	2.5e+02	13.8	Aspartyl protease
3	PF13975 gag-asp_proteas	0.88	21.5	gag-polyprotein putative aspartyl protease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337501

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441755	0.734	Dual specificity tyrosine-phosphorylation-regulated kinase 4
2	9606.ENSP00000261880	0.685	Alpha- and gamma-adaptin-binding protein p34
3	9606.ENSP00000308727	0.682	Sushi domain containing 5
4	9606.ENSP00000480660	0.632	Glutamate receptor-interacting protein 2
5	9606.ENSP00000343140	0.611	Xin actin-binding repeat-containing protein 1
6	9606.ENSP00000221494	0.602	Splicing factor 3A subunit 2
7	9606.ENSP00000001008	0.600	Peptidyl-prolyl cis-trans isomerase FKBP4
8	9606.ENSP00000350708	0.596	UV excision repair protein RAD23 homolog B
9	9606.ENSP00000467024	0.596	UV excision repair protein RAD23 homolog A
10	9606.ENSP00000011898	0.567	Tetraspanin-9
11	9606.ENSP00000310129	0.550	26S proteasome non-ATPase regulatory subunit 2
12	9606.ENSP00000261177	0.542	Tetraspanin-11
13	9606.ENSP00000394751	0.530	Interactor protein for cytohesin exchange factors 1
14	9606.ENSP00000435565	0.529	Maestro heat like repeat family member 1
15	9606.ENSP00000357879	0.502	26S proteasome non-ATPase regulatory subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.992	regulation of metabolic process
GO:0009987	0.991	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0080090	0.978	regulation of primary metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0007166	0.975	cell surface receptor signaling pathway
GO:0019219	0.960	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0048519	0.946	negative regulation of biological process
GO:0048523	0.849	negative regulation of cellular process
GO:0031326	0.809	regulation of cellular biosynthetic process
GO:0010556	0.802	regulation of macromolecule biosynthetic process
GO:0010468	0.796	regulation of gene expression
GO:0006355	0.747	regulation of DNA-templated transcription
GO:0007219	0.622	Notch signaling pathway
GO:0071704	0.565	organic substance metabolic process
GO:0044238	0.548	primary metabolic process
GO:0006807	0.543	nitrogen compound metabolic process
GO:0045934	0.503	negative regulation of nucleobase-containing compound metabolic process
GO:0043170	0.500	macromolecule metabolic process
GO:0045892	0.494	negative regulation of DNA-templated transcription
GO:1901564	0.483	organonitrogen compound metabolic process
GO:0006357	0.473	regulation of transcription by RNA polymerase II
GO:0019538	0.461	protein metabolic process
GO:0000122	0.406	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0005634	0.958	nucleus
GO:0031981	0.456	nuclear lumen
GO:0005654	0.427	nucleoplasm
GO:0005829	0.402	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]