StarFunc result for job id Q9BQL6

User Input

>input (677 residues)
MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFA
LWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKA
VSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSSVSP
GLYSKTMTPIYDPINGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFAGESEVDEIEAALSNLEVTLEGGKAD
SLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADS
SYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKRHKSKQLAARILEAH
QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIP
VTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQL6	1.000	1.000	0.000	677	1.000	1.000	Q9BQL6.pdb.gz	FERM1_HUMAN Fermitin family homolog 1 OS=Homo sapiens OX=9606 GN=FERMT1 PE=1 SV=1
2	AFDB:P59113	0.795	0.795	2.124E-102	677	0.877	0.877	P59113.pdb.gz	FERM1_MOUSE Fermitin family homolog 1 OS=Mus musculus OX=10090 GN=Fermt1 PE=1 SV=4
3	AFDB:F1Q8X5	0.878	0.870	2.577E-85	684	0.619	0.613	F1Q8X5.pdb.gz	FERM2_DANRE Fermitin family homolog 2 OS=Danio rerio OX=7955 GN=fermt2 PE=2 SV=1
4	AFDB:Q86UX7	0.871	0.883	4.558E-78	667	0.545	0.553	Q86UX7.pdb.gz	URP2_HUMAN Fermitin family homolog 3 OS=Homo sapiens OX=9606 GN=FERMT3 PE=1 SV=1
5	AFDB:H0YJ34	0.773	0.814	1.423E-74	640	0.586	0.620	H0YJ34.pdb.gz	H0YJ34_HUMAN FERM domain containing kindlin 2 (Fragment) OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
6	AFDB:Q9VZI3	0.805	0.772	3.614E-65	708	0.443	0.424	Q9VZI3.pdb.gz	UN112_DROME Unc-112-related protein OS=Drosophila melanogaster OX=7227 GN=Fit1 PE=1 SV=1
7	AFDB:Q9VVD2	0.790	0.751	5.833E-64	715	0.445	0.421	Q9VVD2.pdb.gz	Q9VVD2_DROME Fermitin 2 OS=Drosophila melanogaster OX=7227 GN=Fit2 PE=2 SV=1
8	AFDB:Q18685	0.804	0.758	9.586E-64	720	0.442	0.415	Q18685.pdb.gz	UN112_CAEEL Protein unc-112 OS=Caenorhabditis elegans OX=6239 GN=unc-112 PE=1 SV=1
9	PDB:7c3mA	0.606	0.708	3.115E-61	577	0.499	0.586	7c3mA.pdb.gz
10	AFDB:G5EGK1	0.468	0.135	2.002E-18	2553	0.143	0.038	G5EGK1.pdb.gz	G5EGK1_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
11	AFDB:M9PF06	0.403	0.509	4.657E-18	513	0.154	0.203	M9PF06.pdb.gz	M9PF06_DROME Rhea, isoform I OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
12	PDB:3ljuX	0.160	0.243	4.461E-6	373	0.043	0.078	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:4rm8A	0.291	0.517	6.315E-6	368	0.095	0.174	4rm8A.pdb.gz
14	PDB:6r9tA	0.141	0.053	1.266E-5	2185	0.062	0.019	6r9tA.pdb.gz
15	PDB:6u3eA	0.131	0.210	8.783E-5	397	0.058	0.098	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:6yvaC	0.102	0.414	1.443E-4	155	0.025	0.110	6yvaC.pdb.gz
17	PDB:7nkyQ	0.144	0.207	1.760E-4	404	0.046	0.077	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
18	PDB:7rbsB	0.103	0.399	3.040E-4	157	0.027	0.115	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
19	PDB:6bbpA	0.123	0.157	5.798E-4	520	0.052	0.067	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:4mk0A	0.120	0.128	9.066E-4	631	0.081	0.087	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RRM8	0.0	674	545	0.483	0.600	A0A0U1RRM8_HUMAN FERM domain containing kindlin 2 (Fragment) OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
2	F1Q8X5	0.0	857	684	0.626	0.620	FERM2_DANRE Fermitin family homolog 2 OS=Danio rerio OX=7955 GN=fermt2 PE=2 SV=1
3	H0YJ34	0.0	798	640	0.597	0.631	H0YJ34_HUMAN FERM domain containing kindlin 2 (Fragment) OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
4	P59113	0.0	1212	677	0.879	0.879	FERM1_MOUSE Fermitin family homolog 1 OS=Mus musculus OX=10090 GN=Fermt1 PE=1 SV=4
5	Q18685	0.0	540	720	0.462	0.435	UN112_CAEEL Protein unc-112 OS=Caenorhabditis elegans OX=6239 GN=unc-112 PE=1 SV=1
6	Q86UX7	0.0	711	667	0.547	0.555	URP2_HUMAN Fermitin family homolog 3 OS=Homo sapiens OX=9606 GN=FERMT3 PE=1 SV=1
7	Q8CIB5	0.0	852	680	0.632	0.629	FERM2_MOUSE Fermitin family homolog 2 OS=Mus musculus OX=10090 GN=Fermt2 PE=1 SV=1
8	Q8K1B8	0.0	737	665	0.547	0.556	URP2_MOUSE Fermitin family homolog 3 OS=Mus musculus OX=10090 GN=Fermt3 PE=1 SV=1
9	Q96AC1	0.0	861	680	0.634	0.631	FERM2_HUMAN Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
10	Q9BQL6	0.0	1407	677	1.000	1.000	FERM1_HUMAN Fermitin family homolog 1 OS=Homo sapiens OX=9606 GN=FERMT1 PE=1 SV=1
11	Q9VVD2	0.0	552	715	0.443	0.420	Q9VVD2_DROME Fermitin 2 OS=Drosophila melanogaster OX=7227 GN=Fit2 PE=2 SV=1
12	Q9VZI3	0.0	554	708	0.461	0.441	UN112_DROME Unc-112-related protein OS=Drosophila melanogaster OX=7227 GN=Fit1 PE=1 SV=1
13	G3V3J0	1.30e-40	147	155	0.134	0.587	G3V3J0_HUMAN FERM domain containing kindlin 2 (Fragment) OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
14	Q9Y490	6.57e-10	65.1	2541	0.047	0.013	TLN1_HUMAN Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3
15	P26039	6.74e-10	65.1	2541	0.047	0.013	TLN1_MOUSE Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2
16	G3V852	6.79e-10	65.1	2541	0.047	0.013	G3V852_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
17	A0A8I6ABG6	7.16e-10	65.1	2558	0.047	0.013	A0A8I6ABG6_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
18	P54939	1.12e-08	61.2	2541	0.050	0.013	TLN1_CHICK Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2
19	A0A3G2LGI8	1.71e-08	60.5	2531	0.052	0.014	TLN_OSCPE Talin OS=Oscarella pearsei OX=1940113 GN=TLN PE=1 SV=1
20	Q9Y4G6	1.85e-08	60.5	2542	0.046	0.012	TLN2_HUMAN Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00373 FERM_M	1.1e-38	143.6	FERM central domain
2	PF18124 Kindlin_2_N	2.6e-34	128.6	Kindlin-2 N-terminal domain
3	PF00169 PH	5.8e-08	44.5	PH domain
4	PF18012 PH_17	1.7e+02	13.4	PH domain
5	PF00788 RA	1.4e+02	14.6	Ras association (RalGDS/AF-6) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217289

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379975	0.948	Integrin-linked protein kinase
2	9606.ENSP00000416387	0.864	Filamin-binding LIM protein 1
3	9606.ENSP00000379350	0.746	Integrin beta-1
4	9606.ENSP00000246024	0.731	Thioredoxin related transmembrane protein 4
5	9606.ENSP00000334008	0.720	Alpha-parvin
6	9606.ENSP00000452786	0.712	Integrin beta-3
7	9606.ENSP00000364543	0.694	Helicase SKI2W
8	9606.ENSP00000279227	0.693	Fermitin family homolog 3
9	9606.ENSP00000368066	0.690	Hydroxyacid oxidase 1
10	9606.ENSP00000368135	0.690	Leucine-rich repeat neuronal protein 4
11	9606.ENSP00000368305	0.685	Glycerophosphocholine phosphodiesterase GPCPD1
12	9606.ENSP00000351596	0.680	Tetratricopeptide repeat protein 37
13	9606.ENSP00000261647	0.679	Tetratricopeptide repeat protein 19, mitochondrial
14	9606.ENSP00000222573	0.664	Integrin beta-8
15	9606.ENSP00000368140	0.661	Cardiolipin synthase (CMP-forming)
16	9606.ENSP00000211998	0.660	Vinculin
17	9606.ENSP00000267257	0.660	Paxillin
18	9606.ENSP00000203001	0.654	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
19	9606.ENSP00000428780	0.648	Claudin-23
20	9606.ENSP00000304437	0.633	Protein very KIND

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0003779	0.999	actin binding
GO:0051015	0.909	actin filament binding
GO:0005102	0.819	signaling receptor binding
GO:0019899	0.351	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0048583	0.971	regulation of response to stimulus
GO:0048522	0.931	positive regulation of cellular process
GO:0032501	0.927	multicellular organismal process
GO:0007155	0.920	cell adhesion
GO:0048584	0.919	positive regulation of response to stimulus
GO:0071840	0.885	cellular component organization or biogenesis
GO:0016043	0.882	cellular component organization
GO:0001952	0.874	regulation of cell-matrix adhesion
GO:0010811	0.853	positive regulation of cell-substrate adhesion
GO:0072091	0.849	regulation of stem cell proliferation
GO:0040012	0.847	regulation of locomotion
GO:0009967	0.826	positive regulation of signal transduction
GO:1900180	0.800	regulation of protein localization to nucleus
GO:0030334	0.798	regulation of cell migration
GO:0044087	0.797	regulation of cellular component biogenesis
GO:0019222	0.789	regulation of metabolic process
GO:0060255	0.763	regulation of macromolecule metabolic process
GO:0032502	0.739	developmental process
GO:0048519	0.733	negative regulation of biological process
GO:0051239	0.725	regulation of multicellular organismal process
GO:0048523	0.722	negative regulation of cellular process
GO:0050793	0.721	regulation of developmental process
GO:0016477	0.719	cell migration
GO:1903036	0.715	positive regulation of response to wounding
GO:0051128	0.699	regulation of cellular component organization
GO:0050896	0.656	response to stimulus
GO:0048856	0.648	anatomical structure development
GO:0061041	0.610	regulation of wound healing
GO:0043062	0.530	extracellular structure organization
GO:0090287	0.519	regulation of cellular response to growth factor stimulus
GO:0040017	0.462	positive regulation of locomotion
GO:0048585	0.460	negative regulation of response to stimulus
GO:0051716	0.441	cellular response to stimulus
GO:0010468	0.420	regulation of gene expression
GO:0007154	0.419	cell communication
GO:0023052	0.385	signaling
GO:0007165	0.384	signal transduction
GO:0051171	0.378	regulation of nitrogen compound metabolic process
GO:0090130	0.376	tissue migration
GO:0001954	0.361	positive regulation of cell-matrix adhesion
GO:0007275	0.342	multicellular organism development
GO:0080090	0.334	regulation of primary metabolic process
GO:0031589	0.329	cell-substrate adhesion
GO:0001667	0.305	ameboidal-type cell migration
GO:0009893	0.303	positive regulation of metabolic process
GO:0031323	0.302	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.997	intracellular anatomical structure
GO:0005925	0.996	focal adhesion
GO:0005737	0.962	cytoplasm
GO:0005829	0.940	cytosol
GO:0071944	0.932	cell periphery
GO:0043226	0.919	organelle
GO:0043229	0.891	intracellular organelle
GO:0043227	0.765	membrane-bounded organelle
GO:0070013	0.761	intracellular organelle lumen
GO:0016020	0.755	membrane
GO:0005886	0.727	plasma membrane
GO:0043231	0.643	intracellular membrane-bounded organelle
GO:0031981	0.496	nuclear lumen
GO:0005654	0.450	nucleoplasm
GO:0043232	0.303	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]