StarFunc result for job id Q9BQP9

User Input

>input (254 residues)
MMCPLWRLLIFLGLLALPLAPHKQPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNI
HFGDRLNASAQVAPGLVGWLISGRKHQQQQESSINITNIQLDCGGIQISFHKEWFSANIS
LEFDLELRPSFDNNIVKMCAHMSIVVEFWLEKDEFGRRDLVIGKCDAEPSSVHVAILTEA
IPPKMNQFLYNLKENLQKVLPHMVESQVCPLIGEILGQLDVKLLKSLIEQEAAHEPTHHE
TSQPSACQAGESPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NP55	0.609	0.605	1.004E-12	256	0.205	0.203	Q9NP55.pdb.gz	BPIA1_HUMAN BPI fold-containing family A member 1 OS=Homo sapiens OX=9606 GN=BPIFA1 PE=1 SV=1
2	AFDB:P97361	0.608	0.559	2.109E-12	278	0.228	0.209	P97361.pdb.gz	BPIA1_MOUSE BPI fold-containing family A member 1 OS=Mus musculus OX=10090 GN=Bpifa1 PE=1 SV=3
3	PDB:6baqF	0.596	0.708	3.949E-11	211	0.197	0.237	6baqF.pdb.gz
4	AFDB:P82615	0.621	0.684	6.475E-11	228	0.173	0.193	P82615.pdb.gz	LATH_HORSE Latherin OS=Equus caballus OX=9796 GN=LATH PE=1 SV=3
5	PDB:3zpmA	0.612	0.723	8.131E-10	211	0.165	0.199	3zpmA.pdb.gz
6	AFDB:Q8TDL5	0.557	0.305	2.645E-9	484	0.173	0.091	Q8TDL5.pdb.gz	BPIB1_HUMAN BPI fold-containing family B member 1 OS=Homo sapiens OX=9606 GN=BPIFB1 PE=1 SV=1
7	AFDB:Q96DR5	0.528	0.537	2.800E-9	249	0.114	0.116	Q96DR5.pdb.gz	BPIA2_HUMAN BPI fold-containing family A member 2 OS=Homo sapiens OX=9606 GN=BPIFA2 PE=1 SV=2
8	PDB:4kegA	0.507	0.257	1.411E-8	535	0.181	0.086	4kegA.pdb.gz	The Lipid Ligands of the SPLUNC1 Protein
9	AFDB:P07743	0.455	0.488	1.521E-7	235	0.146	0.157	P07743.pdb.gz	BPIA2_MOUSE BPI fold-containing family A member 2 OS=Mus musculus OX=10090 GN=Bpifa2 PE=1 SV=1
10	AFDB:Q63471	0.445	0.478	3.383E-7	235	0.134	0.145	Q63471.pdb.gz	BPIA2_RAT BPI fold-containing family A member 2 OS=Rattus norvegicus OX=10116 GN=Bpifa2 PE=1 SV=1
11	AFDB:P59826	0.396	0.230	2.224E-6	476	0.169	0.090	P59826.pdb.gz	BPIB3_HUMAN BPI fold-containing family B member 3 OS=Homo sapiens OX=9606 GN=BPIFB3 PE=1 SV=3
12	AFDB:Q67E05	0.368	0.222	1.100E-5	483	0.142	0.075	Q67E05.pdb.gz	BPI_MOUSE Bactericidal permeability-increasing protein OS=Mus musculus OX=10090 GN=Bpi PE=1 SV=1
13	AFDB:P18428	0.351	0.216	1.305E-5	481	0.165	0.087	P18428.pdb.gz	LBP_HUMAN Lipopolysaccharide-binding protein OS=Homo sapiens OX=9606 GN=LBP PE=1 SV=3
14	PDB:4m4dA	0.322	0.213	1.578E-5	448	0.157	0.089	4m4dA.pdb.gz
15	PDB:4ewsA	0.360	0.223	3.315E-5	472	0.114	0.061	4ewsA.pdb.gz	Crystal structures of cholesteryl ester transfer protein in complex with inhibitors.
16	PDB:3h4zA	0.305	0.168	7.802E-5	568	0.110	0.049	3h4zA.pdb.gz	The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
17	PDB:1bp1A	0.383	0.238	1.099E-4	456	0.114	0.064	1bp1A.pdb.gz
18	PDB:6xlfC	0.266	0.227	1.184E-2	316	0.087	0.070	6xlfC.pdb.gz	Cryo-EM structures reveal a multistep mechanism of Hsp90 activation by co-chaperone Aha1
19	PDB:5gpkB	0.133	0.153	2.487E-2	207	0.071	0.087	5gpkB.pdb.gz
20	PDB:6xlbC1	0.187	0.174	4.933E-2	284	0.071	0.063	6xlbC1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97361	2.69e-13	70.1	278	0.173	0.158	BPIA1_MOUSE BPI fold-containing family A member 1 OS=Mus musculus OX=10090 GN=Bpifa1 PE=1 SV=3
2	Q8K4I4	1.43e-11	65.1	270	0.169	0.159	BPIA1_RAT BPI fold-containing family A member 1 OS=Rattus norvegicus OX=10116 GN=Bpifa1 PE=2 SV=1
3	Q9NP55	3.10e-10	61.2	256	0.154	0.152	BPIA1_HUMAN BPI fold-containing family A member 1 OS=Homo sapiens OX=9606 GN=BPIFA1 PE=1 SV=1
4	P82615	0.003	40.0	228	0.169	0.189	LATH_HORSE Latherin OS=Equus caballus OX=9796 GN=LATH PE=1 SV=3
5	Q96DR5	0.003	40.4	249	0.079	0.080	BPIA2_HUMAN BPI fold-containing family A member 2 OS=Homo sapiens OX=9606 GN=BPIFA2 PE=1 SV=2
6	A0A669KBJ0	0.12	36.2	736	0.102	0.035	A0A669KBJ0_HUMAN BPI fold containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=1 SV=1
7	P59827	0.13	35.8	614	0.102	0.042	BPIB4_HUMAN BPI fold-containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=2 SV=2
8	M9PE03	0.99	33.5	3536	0.091	0.007	M9PE03_DROME Zormin, isoform E OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
9	M9PBJ1	1.0	33.1	3664	0.091	0.006	M9PBJ1_DROME Zormin, isoform J OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
10	Q0E8J3	1.0	33.1	3640	0.091	0.006	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
11	Q0E8J4	1.0	33.1	3079	0.091	0.007	Q0E8J4_DROME Zormin, isoform G OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
12	Q0E8J5	1.0	33.1	2960	0.091	0.008	Q0E8J5_DROME Zormin, isoform K OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
13	Q7Z1Y4	1.1	33.1	2935	0.091	0.008	Q7Z1Y4_DROME Zormin OS=Drosophila melanogaster OX=7227 GN=zormin PE=4 SV=1
14	Q9W053	1.1	33.1	2935	0.091	0.008	Q9W053_DROME Zormin, isoform F OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=4
15	P02535	1.5	32.3	570	0.106	0.047	K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3
16	Q54QE9	4.4	31.2	592	0.118	0.051	Q54QE9_DICDI HSP20-like chaperone domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0283911 PE=4 SV=1
17	Q5UPJ7	5.5	30.4	346	0.079	0.058	SYY_MIMIV Tyrosine--tRNA ligase OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=YARS PE=1 SV=1
18	P68806	7.2	29.3	120	0.039	0.083	MSCL_STAAW Large-conductance mechanosensitive channel OS=Staphylococcus aureus (strain MW2) OX=196620 GN=mscL PE=1 SV=1
19	Q6G9L1	7.2	29.3	120	0.039	0.083	MSCL_STAAS Large-conductance mechanosensitive channel OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=mscL PE=1 SV=1
20	Q9SQU6	7.3	30.4	486	0.098	0.051	PP216_ARATH Pentatricopeptide repeat-containing protein At3g06430, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB2750 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01273 LBP_BPI_CETP	3e-22	90.5	LBP / BPI / CETP family, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364603

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344929	0.715	BPI fold containing family B member 6
2	9606.ENSP00000364643	0.697	BPI fold-containing family B member 3
3	9606.ENSP00000253354	0.679	BPI fold-containing family B member 1
4	9606.ENSP00000364632	0.658	BPI fold-containing family B member 4
5	9606.ENSP00000170150	0.654	BPI fold containing family B member 2
6	9606.ENSP00000253362	0.622	BPI fold-containing family A member 2
7	9606.ENSP00000291715	0.560	Claudin domain containing 2
8	9606.ENSP00000385247	0.517	Calpain-14
9	9606.ENSP00000285518	0.507	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
10	9606.ENSP00000314500	0.503	Polypeptide N-acetylgalactosaminyltransferase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.871	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.668	multicellular organismal process
GO:0065007	0.625	biological regulation
GO:0050896	0.622	response to stimulus
GO:0050789	0.559	regulation of biological process
GO:0009987	0.451	cellular process
GO:0050794	0.358	regulation of cellular process
GO:0048519	0.343	negative regulation of biological process
GO:0048523	0.326	negative regulation of cellular process
GO:0006950	0.302	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005576	0.992	extracellular region
GO:0005615	0.884	extracellular space
GO:0005622	0.836	intracellular anatomical structure
GO:0043226	0.809	organelle
GO:0043229	0.754	intracellular organelle
GO:0005737	0.733	cytoplasm
GO:0043227	0.662	membrane-bounded organelle
GO:0012505	0.425	endomembrane system
GO:0070013	0.344	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]