StarFunc result for job id Q9BQQ3

User Input

>input (440 residues)
MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLK
ANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEP
SSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTP
NAAWGGEGSLGCGIGYGYLHRIPTQPPSYHKKPPGTPPPSALPLGAPPPDALPPGPTPED
SPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAPDPDGLPHFMETPLQPPPPVQ
RVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSSSSHERGGEAT
WSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG
LDTGTEAEGLDSQAQISTTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2U5	0.518	0.518	3.033E-66	440	1.000	1.000	A0A024R2U5.pdb.gz
2	AFDB:O35254	0.489	0.478	5.617E-57	451	0.818	0.798	O35254.pdb.gz	GORS1_RAT Golgi reassembly-stacking protein 1 OS=Rattus norvegicus OX=10116 GN=Gorasp1 PE=1 SV=4
3	AFDB:Q9H8Y8	0.468	0.456	8.017E-36	452	0.441	0.429	Q9H8Y8.pdb.gz	GORS2_HUMAN Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3
4	AFDB:Q9R064	0.499	0.484	4.066E-35	454	0.418	0.405	Q9R064.pdb.gz	GORS2_RAT Golgi reassembly-stacking protein 2 OS=Rattus norvegicus OX=10116 GN=Gorasp2 PE=1 SV=3
5	AFDB:Q9VW57	0.466	0.447	2.970E-33	460	0.373	0.357	Q9VW57.pdb.gz	Q9VW57_DROME Grasp65 OS=Drosophila melanogaster OX=7227 GN=Grasp65 PE=1 SV=1
6	PDB:7w6xA	0.182	0.180	7.884E-8	447	0.095	0.094	7w6xA.pdb.gz	Mechanistic insights into intramembrane proteolysis by E. coli site-2 protease homolog RseP.
7	PDB:3pv2B	0.158	0.178	1.946E-5	388	0.068	0.077	3pv2B.pdb.gz
8	PDB:1ky9B	0.140	0.154	4.279E-3	396	0.075	0.083	1ky9B.pdb.gz
9	PDB:5t69A	0.141	0.215	1.082E-2	284	0.032	0.049	5t69A.pdb.gz
10	PDB:4c2eA	0.145	0.147	2.900E-2	435	0.039	0.039	4c2eA.pdb.gz
11	PDB:4a8cA	0.111	0.122	3.256E-2	395	0.064	0.071	4a8cA.pdb.gz
12	PDB:3gdvA	0.130	0.190	8.235E-2	296	0.059	0.088	3gdvA.pdb.gz	OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
13	PDB:7co5H	0.142	0.190	9.248E-2	325	0.027	0.037	7co5H.pdb.gz	Molecular Basis of the Versatile Regulatory Mechanism of HtrA-Type Protease AlgW from Pseudomonas aeruginosa.
14	PDB:4jj0A	0.130	0.292	1.965E-1	181	0.027	0.066	4jj0A.pdb.gz	Structural insight into magnetochrome-mediated magnetite biomineralization.
15	PDB:1n6dA	0.127	0.059	2.083E-1	1023	0.020	0.009	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
16	AFDB:F4JFN7	0.078	0.073	2.859E-1	495	0.150	0.133	F4JFN7.pdb.gz	F4JFN7_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g07810 PE=1 SV=1
17	AFDB:D4A0I8	0.067	0.038	6.824E-1	931	0.136	0.064	D4A0I8.pdb.gz	D4A0I8_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
18	AFDB:B2RQC2	0.077	0.037	8.606E-1	1324	0.136	0.045	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
19	AFDB:A0A0S2Z4Z0	0.138	0.101	9.664E-1	669	0.152	0.100	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
20	AFDB:Q8I5B3	0.072	0.046	1.150	822	0.123	0.066	Q8I5B3.pdb.gz	Q8I5B3_PLAF7 Protein transport protein SEC13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1230700 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1WBR1	0.0	686	446	0.825	0.814	B1WBR1_RAT Golgi reassembly stacking protein 1 OS=Rattus norvegicus OX=10116 GN=Gorasp1 PE=1 SV=1
2	B4E1H8	0.0	639	345	0.736	0.939	B4E1H8_HUMAN Golgi reassembly stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1 PE=1 SV=1
3	O35254	0.0	683	451	0.820	0.800	GORS1_RAT Golgi reassembly-stacking protein 1 OS=Rattus norvegicus OX=10116 GN=Gorasp1 PE=1 SV=4
4	Q91X51	0.0	675	446	0.836	0.825	GORS1_MOUSE Golgi reassembly-stacking protein 1 OS=Mus musculus OX=10090 GN=Gorasp1 PE=1 SV=3
5	Q9BQQ3	0.0	884	440	1.000	1.000	GORS1_HUMAN Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1 PE=1 SV=3
6	B3KPY8	5.96e-160	454	285	0.536	0.828	B3KPY8_HUMAN Golgi reassembly stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1 PE=1 SV=1
7	Q9R064	2.51e-106	324	454	0.325	0.315	GORS2_RAT Golgi reassembly-stacking protein 2 OS=Rattus norvegicus OX=10116 GN=Gorasp2 PE=1 SV=3
8	Q9H8Y8	3.60e-106	323	452	0.325	0.316	GORS2_HUMAN Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3
9	Q9VW57	1.06e-93	292	460	0.289	0.276	Q9VW57_DROME Grasp65 OS=Drosophila melanogaster OX=7227 GN=Grasp65 PE=1 SV=1
10	Q54C46	5.88e-59	197	327	0.214	0.287	Q54C46_DICDI Golgi reassembly stacking protein OS=Dictyostelium discoideum OX=44689 GN=grpA PE=4 SV=1
11	Q10149	5.88e-32	126	345	0.223	0.284	YAT2_SCHPO Uncharacterized protein C1D4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1D4.02c PE=3 SV=2
12	Q386P4	4.24e-24	106	499	0.166	0.146	Q386P4_TRYB2 Golgi reassembly stacking protein (GRASP homologue), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0260 PE=4 SV=1
13	Q04410	2.74e-12	70.1	372	0.095	0.113	GRH1_YEAST GRASP65 homolog protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRH1 PE=1 SV=1
14	Q9WTV5	1.53e-04	45.1	222	0.066	0.131	PSMD9_RAT 26S proteasome non-ATPase regulatory subunit 9 OS=Rattus norvegicus OX=10116 GN=Psmd9 PE=1 SV=1
15	O00233	0.018	38.9	223	0.061	0.121	PSMD9_HUMAN 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens OX=9606 GN=PSMD9 PE=1 SV=3
16	Q57X08	0.31	35.0	222	0.066	0.131	Q57X08_TRYB2 Proteasome 26S non-ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.470 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04495 GRASP55_65	5.5e-70	245.5	GRASP55/65 PDZ-like domain
2	PF13180 PDZ_2	2.6e-05	35.8	PDZ domain
3	PF17820 PDZ_6	0.013	26.7	PDZ domain
4	PF02163 Peptidase_M50	1.3e-05	36.3	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313869

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416097	0.999	Golgin subfamily A member 2
2	9606.ENSP00000300093	0.995	Serine/threonine-protein kinase PLK1
3	9606.ENSP00000444850	0.984	General vesicular transport factor p115
4	9606.ENSP00000356782	0.977	Golgin-45
5	9606.ENSP00000387286	0.973	Ras-related protein Rab-1A
6	9606.ENSP00000390783	0.970	Sec1 family domain-containing protein 1
7	9606.ENSP00000378699	0.956	Cyclin-dependent kinase 1
8	9606.ENSP00000377275	0.935	Golgin subfamily B member 1
9	9606.ENSP00000294179	0.926	Syntaxin-5
10	9606.ENSP00000256442	0.911	G2/mitotic-specific cyclin-B1
11	9606.ENSP00000259400	0.909	Syntaxin-17
12	9606.ENSP00000288207	0.903	G2/mitotic-specific cyclin-B2
13	9606.ENSP00000373312	0.890	Protein SEC13 homolog
14	9606.ENSP00000428564	0.871	Protein transport protein Sec24B
15	9606.ENSP00000299705	0.848	Transmembrane emp24 domain-containing protein 3
16	9606.ENSP00000163416	0.846	Golgin subfamily A member 5
17	9606.ENSP00000310226	0.843	Ras-related protein Rab-1B
18	9606.ENSP00000463393	0.843	Vesicle-trafficking protein SEC22b
19	9606.ENSP00000343405	0.842	Protein transport protein Sec24C
20	9606.ENSP00000355629	0.839	Conserved oligomeric Golgi complex subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.968	biological regulation
GO:0050789	0.955	regulation of biological process
GO:0050794	0.933	regulation of cellular process
GO:0072657	0.829	protein localization to membrane
GO:0045184	0.823	establishment of protein localization
GO:1990778	0.781	protein localization to cell periphery
GO:0016043	0.780	cellular component organization
GO:0006996	0.769	organelle organization
GO:0048519	0.768	negative regulation of biological process
GO:0060284	0.768	regulation of cell development
GO:0051128	0.743	regulation of cellular component organization
GO:0051960	0.743	regulation of nervous system development
GO:0051093	0.734	negative regulation of developmental process
GO:0048523	0.709	negative regulation of cellular process
GO:0010256	0.606	endomembrane system organization
GO:0048814	0.602	regulation of dendrite morphogenesis
GO:0006810	0.601	transport
GO:0051961	0.601	negative regulation of nervous system development
GO:0010721	0.587	negative regulation of cell development
GO:0007030	0.564	Golgi organization
GO:0050768	0.557	negative regulation of neurogenesis
GO:0031345	0.553	negative regulation of cell projection organization
GO:0072659	0.405	protein localization to plasma membrane
GO:0008152	0.367	metabolic process
GO:0090150	0.328	establishment of protein localization to membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.984	membrane
GO:0031090	0.970	organelle membrane
GO:0098588	0.902	bounding membrane of organelle
GO:0000139	0.884	Golgi membrane
GO:0005829	0.452	cytosol
GO:0005793	0.388	endoplasmic reticulum-Golgi intermediate compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]