StarFunc result for job id Q9BQQ7

User Input

>input (232 residues)
MAGDTEVWKQMFQELMREVKPWHRWTLRPDKGLLPNVLKPGWMQYQQWTFARFQCSSCSR
NWASAQVLVLFHMNWSEEKSRGQVKMRVFTQRCKKCPQPLFEDPEFTQENISRILKNLVF
RILKKCYRGRFQLIEEVPMIKDISLEGPHNSDNCEACLQGFCAGPIQVTSLPPSQTPRVH
SIYKVEEVVKPWASGENVYSYACQNHICRNLSIFCCCVILIVIVVIVVKTAI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQQ7	1.000	1.000	2.990E-48	232	1.000	1.000	Q9BQQ7.pdb.gz	RTP3_HUMAN Receptor-transporting protein 3 OS=Homo sapiens OX=9606 GN=RTP3 PE=1 SV=1
2	AFDB:Q96DX8	0.683	0.646	5.230E-26	246	0.414	0.390	Q96DX8.pdb.gz	RTP4_HUMAN Receptor-transporting protein 4 OS=Homo sapiens OX=9606 GN=RTP4 PE=1 SV=3
3	AFDB:Q9ER80	0.615	0.575	7.168E-20	249	0.332	0.309	Q9ER80.pdb.gz	RTP4_MOUSE Receptor-transporting protein 4 OS=Mus musculus OX=10090 GN=Rtp4 PE=1 SV=1
4	AFDB:P59025	0.629	0.557	4.034E-19	263	0.302	0.266	P59025.pdb.gz	RTP1_HUMAN Receptor-transporting protein 1 OS=Homo sapiens OX=9606 GN=RTP1 PE=2 SV=2
5	AFDB:Q5QGT7	0.599	0.617	1.018E-18	225	0.284	0.293	Q5QGT7.pdb.gz	RTP2_HUMAN Receptor-transporting protein 2 OS=Homo sapiens OX=9606 GN=RTP2 PE=1 SV=1
6	AFDB:Q80ZI2	0.601	0.625	2.415E-18	223	0.259	0.269	Q80ZI2.pdb.gz	RTP2_MOUSE Receptor-transporting protein 2 OS=Mus musculus OX=10090 GN=Rtp2 PE=1 SV=1
7	AFDB:Q14D33	0.485	0.209	5.081E-15	572	0.276	0.112	Q14D33.pdb.gz	RTP5_HUMAN Receptor-transporting protein 5 OS=Homo sapiens OX=9606 GN=RTP5 PE=1 SV=2
8	AFDB:P49797	0.149	0.048	1.663E-2	967	0.125	0.030	P49797.pdb.gz	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
9	PDB:5yzgY	0.123	0.134	1.915E-2	204	0.060	0.069	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
10	PDB:5mrcF	0.161	0.182	1.146E-1	196	0.052	0.061	5mrcF.pdb.gz	The structure of the yeast mitochondrial ribosome.
11	AFDB:Q22354	0.139	0.053	1.631E-1	862	0.116	0.031	Q22354.pdb.gz	Q22354_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rhgf-2 PE=1 SV=1
12	PDB:7pfo4	0.084	0.048	1.765E-1	619	0.069	0.026	7pfo4.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
13	PDB:4ebrA	0.130	0.178	2.124E-1	157	0.052	0.076	4ebrA.pdb.gz
14	PDB:6xtx4	0.090	0.049	2.124E-1	598	0.056	0.022	6xtx4.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
15	PDB:5cskB	0.126	0.027	2.556E-1	2017	0.069	0.008	5cskB.pdb.gz
16	AFDB:Q8TE67	0.105	0.055	2.842E-1	593	0.091	0.035	Q8TE67.pdb.gz	ES8L3_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3 PE=1 SV=2
17	PDB:7ob9M	0.082	0.054	2.892E-1	388	0.060	0.036	7ob9M.pdb.gz	Cryo-EM structures of human RNA polymerase I.
18	PDB:1iznA	0.145	0.126	3.272E-1	275	0.047	0.040	1iznA.pdb.gz
19	PDB:5cslA	0.136	0.029	3.480E-1	2050	0.069	0.008	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
20	PDB:7ajtEH	0.079	0.078	3.480E-1	237	0.091	0.089	7ajtEH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQQ7	4.08e-175	482	232	1.000	1.000	RTP3_HUMAN Receptor-transporting protein 3 OS=Homo sapiens OX=9606 GN=RTP3 PE=1 SV=1
2	Q96DX8	1.01e-51	169	246	0.405	0.382	RTP4_HUMAN Receptor-transporting protein 4 OS=Homo sapiens OX=9606 GN=RTP4 PE=1 SV=3
3	Q9ER80	4.32e-44	150	249	0.315	0.293	RTP4_MOUSE Receptor-transporting protein 4 OS=Mus musculus OX=10090 GN=Rtp4 PE=1 SV=1
4	Q5QGT7	9.93e-28	107	225	0.246	0.253	RTP2_HUMAN Receptor-transporting protein 2 OS=Homo sapiens OX=9606 GN=RTP2 PE=1 SV=1
5	Q80ZI2	3.49e-27	105	223	0.259	0.269	RTP2_MOUSE Receptor-transporting protein 2 OS=Mus musculus OX=10090 GN=Rtp2 PE=1 SV=1
6	Q8C8C1	5.92e-25	100	263	0.250	0.221	RTP1_MOUSE Receptor-transporting protein 1 OS=Mus musculus OX=10090 GN=Rtp1 PE=1 SV=1
7	P59025	1.34e-24	100	263	0.254	0.224	RTP1_HUMAN Receptor-transporting protein 1 OS=Homo sapiens OX=9606 GN=RTP1 PE=2 SV=2
8	Q14D33	1.56e-21	94.7	572	0.207	0.084	RTP5_HUMAN Receptor-transporting protein 5 OS=Homo sapiens OX=9606 GN=RTP5 PE=1 SV=2
9	A0A1D8PN92	2.0	32.0	1948	0.121	0.014	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
10	P0AFI9	3.3	31.2	353	0.073	0.048	PERM_ECOLI Putative permease PerM OS=Escherichia coli (strain K12) OX=83333 GN=perM PE=3 SV=1
11	Q9NB71	5.6	30.8	5233	0.091	0.004	HIW_DROME E3 ubiquitin-protein ligase highwire OS=Drosophila melanogaster OX=7227 GN=hiw PE=1 SV=2
12	Q9SIB9	7.9	30.0	990	0.069	0.016	ACO3M_ARATH Aconitate hydratase 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ACO3 PE=1 SV=2
13	Q9Z0E1	7.9	30.0	529	0.060	0.026	M1AP_MOUSE Meiosis 1 arrest protein OS=Mus musculus OX=10090 GN=M1ap PE=1 SV=2
14	Q3TRB0	8.4	30.0	701	0.052	0.017	Q3TRB0_MOUSE A-kinase anchor protein 6 (Fragment) OS=Mus musculus OX=10090 GN=Akap6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12387 Peptidase_C74	72	14.3	Pestivirus NS2 peptidase
2	PF13695 zf-3CxxC	4.1e-26	102.7	Zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296142

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247883	0.725	Taste receptor type 2 member 5
2	9606.ENSP00000371932	0.717	Taste receptor type 2 member 1
3	9606.ENSP00000375095	0.712	Taste receptor type 2 member 13
4	9606.ENSP00000224181	0.660	Complement component C8 gamma chain
5	9606.ENSP00000300145	0.656	Mitochondrial inner membrane protease ATP23 homolog
6	9606.ENSP00000417190	0.653	ATP synthase mitochondrial F1 complex assembly factor 2
7	9606.ENSP00000364520	0.616	Taste receptor type 1 member 2
8	9606.ENSP00000379241	0.603	Leucine-rich repeat-containing protein 2
9	9606.ENSP00000353132	0.578	Diencephalon/mesencephalon homeobox protein 1
10	9606.ENSP00000400839	0.540	Solute carrier family 35 member G2
11	9606.ENSP00000334050	0.531	Taste receptor type 2 member 42
12	9606.ENSP00000211314	0.520	Transmembrane protein 14A
13	9606.ENSP00000346981	0.517	Transmembrane protein 207
14	9606.ENSP00000446335	0.514	Zinc finger protein 362
15	9606.ENSP00000249284	0.513	Taste receptor type 2 member 16
16	9606.ENSP00000390407	0.510	Transmembrane protein 213
17	9606.ENSP00000374234	0.505	Transmembrane protein 72
18	9606.ENSP00000387907	0.500	Protein ANKUB1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050906	0.976	detection of stimulus involved in sensory perception
GO:0050909	0.975	sensory perception of taste
GO:0051649	0.971	establishment of localization in cell
GO:0050913	0.970	sensory perception of bitter taste
GO:0050912	0.967	detection of chemical stimulus involved in sensory perception of taste
GO:0006612	0.930	protein targeting to membrane
GO:0001580	0.388	detection of chemical stimulus involved in sensory perception of bitter taste

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.803	membrane
GO:0071944	0.497	cell periphery
GO:0005886	0.491	plasma membrane
GO:0043231	0.362	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]