StarFunc result for job id Q9BQS7

User Input

>input (1158 residues)
MESGHLLWALLFMQSLWPQLTDGATRVYYLGIRDVQWNYAPKGRNVITNQPLDSDIVASS
FLKSDKNRIGGTYKKTIYKEYKDDSYTDEVAQPAWLGFLGPVLQAEVGDVILIHLKNFAT
RPYTIHPHGVFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPTDADPAC
LTWIYHSHVDAPRDIATGLIGPLITCKRGALDGNSPPQRQDVDHDFFLLFSVVDENLSWH
LNENIATYCSDPASVDKEDETFQESNRMHAINGFVFGNLPELNMCAQKRVAWHLFGMGNE
IDVHTAFFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQAL
YKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKS
SSRIGGTYWKVRYEAFQDETFQEKMHLEEDRHLGILGPVIRAEVGDTIQVVFYNRASQPF
SMQPHGVFYEKDYEGTVYNDGSSYPGLVAKPFEKVTYRWTVPPHAGPTAQDPACLTWMYF
SAADPIRDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQAAA
MLDFRLLSEDIEGFQDSNRMHAINGFLFSNLPRLDMCKGDTVAWHLLGLGTETDVHGVMF
QGNTVQLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQAGSHREAGMRAIYNVSQCPG
HQATPRQRYQAARIYYIMAEEVEWDYCPDRSWEREWHNQSEKDSYGYIFLSNKDGLLGSR
YKKAVFREYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHAHG
VLESTTVWPLAAEPGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPL
AICQKGILEPHGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQDETFLE
SNKMHAINGKLYANLRGLTMYQGERVAWYMLAMGQDVDLHTIHFHAESFLYRNGENYRAD
VVDLFPGTFEVVEMVASNPGTWLMHCHVTDHVHAGMETLFTVFSRTEHLSPLTVITKETE
KAVPPRDIEEGNVKMLGMQIPIKNVEMLASVLVAISVTLLLVVLALGGVVWYQHRQRKLR
RNRRSILDDSFKLLSFKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1kcwA	0.853	0.970	0.000	1017	0.434	0.494	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.
2	PDB:4bxsV	0.751	0.691	0.000	1262	0.321	0.295	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
3	PDB:5n4lA	0.862	0.964	0.000	1034	0.447	0.501	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
4	AFDB:A5PL27	0.881	0.957	0.000	1065	0.441	0.480	A5PL27.pdb.gz	A5PL27_HUMAN CP protein OS=Homo sapiens OX=9606 GN=CP PE=2 SV=1
5	AFDB:Q58L90	0.780	0.622	0.000	1460	0.325	0.258	Q58L90.pdb.gz	FA5V_OXYMI Venom prothrombin activator omicarin-C non-catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1
6	AFDB:Q61147	0.874	0.953	0.000	1061	0.441	0.482	Q61147.pdb.gz	CERU_MOUSE Ceruloplasmin OS=Mus musculus OX=10090 GN=Cp PE=1 SV=2
7	AFDB:Q6MZM0	0.897	0.896	0.000	1159	0.495	0.494	Q6MZM0.pdb.gz	HPHL1_HUMAN Ferroxidase HEPHL1 OS=Homo sapiens OX=9606 GN=HEPHL1 PE=1 SV=2
8	AFDB:Q6P3G1	0.880	0.937	0.000	1087	0.457	0.487	Q6P3G1.pdb.gz
9	AFDB:Q90X47	0.796	0.445	0.000	2101	0.337	0.186	Q90X47.pdb.gz
10	AFDB:Q920H8	0.937	0.938	0.000	1157	0.848	0.849	Q920H8.pdb.gz	HEPH_RAT Hephaestin OS=Rattus norvegicus OX=10116 GN=Heph PE=1 SV=1
11	AFDB:Q9BQS7	1.000	1.000	0.000	1158	1.000	1.000	Q9BQS7.pdb.gz	HEPH_HUMAN Hephaestin OS=Homo sapiens OX=9606 GN=HEPH PE=1 SV=3
12	PDB:7kveB	0.748	0.636	1.845E-100	1374	0.330	0.278	7kveB.pdb.gz
13	AFDB:P12259	0.777	0.412	2.725E-100	2224	0.334	0.174	P12259.pdb.gz	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4
14	AFDB:O88783	0.780	0.422	3.045E-100	2183	0.328	0.174	O88783.pdb.gz	FA5_MOUSE Coagulation factor V OS=Mus musculus OX=10090 GN=F5 PE=1 SV=1
15	PDB:2dv6A	0.184	0.477	5.376E-21	422	0.070	0.192	2dv6A.pdb.gz	Structure and function of a hexameric copper-containing nitrite reductase.
16	PDB:5lwxA	0.177	0.347	6.005E-19	554	0.066	0.137	5lwxA.pdb.gz	Structure and function of Aspergillus niger laccase McoG
17	PDB:3divA	0.187	0.382	2.274E-18	499	0.079	0.184	3divA.pdb.gz	Crystal Structure of laccase from Cerrena maxima at 1.76A resolution.
18	PDB:6im9A	0.177	0.375	3.447E-17	490	0.074	0.176	6im9A.pdb.gz
19	PDB:3qqxA	0.120	0.258	4.676E-16	474	0.066	0.162	3qqxA.pdb.gz	CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release
20	PDB:2uxtA	0.184	0.462	6.523E-16	422	0.058	0.159	2uxtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5PL27	0.0	1076	1065	0.446	0.485	A5PL27_HUMAN CP protein OS=Homo sapiens OX=9606 GN=CP PE=2 SV=1
2	A8K5A4	0.0	1073	1065	0.446	0.485	A8K5A4_HUMAN cDNA FLJ76826, highly similar to Homo sapiens ceruloplasmin (ferroxidase) (CP), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
3	B3KTA8	0.0	792	778	0.333	0.496	B3KTA8_HUMAN cDNA FLJ37971 fis, clone CTONG2009958, highly similar to CERULOPLASMIN OS=Homo sapiens OX=9606 PE=2 SV=1
4	P00450	0.0	1076	1065	0.446	0.485	CERU_HUMAN Ceruloplasmin OS=Homo sapiens OX=9606 GN=CP PE=1 SV=1
5	P13635	0.0	1073	1059	0.450	0.492	CERU_RAT Ceruloplasmin OS=Rattus norvegicus OX=10116 GN=Cp PE=1 SV=3
6	Q1L857	0.0	1008	1006	0.421	0.485	Q1L857_HUMAN Ceruloplasmin (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
7	Q61147	0.0	1069	1061	0.450	0.491	CERU_MOUSE Ceruloplasmin OS=Mus musculus OX=10090 GN=Cp PE=1 SV=2
8	Q6MZM0	0.0	1208	1159	0.489	0.488	HPHL1_HUMAN Ferroxidase HEPHL1 OS=Homo sapiens OX=9606 GN=HEPHL1 PE=1 SV=2
9	Q7ZU12	0.0	1103	1087	0.463	0.493	Q7ZU12_DANRE Ceruloplasmin OS=Danio rerio OX=7955 GN=wu:fi23f10 PE=1 SV=1
10	Q920H8	0.0	2053	1157	0.849	0.850	HEPH_RAT Hephaestin OS=Rattus norvegicus OX=10116 GN=Heph PE=1 SV=1
11	Q9BQS7	0.0	2427	1158	1.000	1.000	HEPH_HUMAN Hephaestin OS=Homo sapiens OX=9606 GN=HEPH PE=1 SV=3
12	Q9Z0Z4	0.0	2076	1157	0.858	0.858	HEPH_MOUSE Hephaestin OS=Mus musculus OX=10090 GN=Heph PE=1 SV=3
13	B7ZVT7	1.37e-131	446	2087	0.215	0.119	B7ZVT7_DANRE Coagulation factor V OS=Danio rerio OX=7955 GN=si:bz20i5.3 PE=2 SV=1
14	P00451	1.04e-122	420	2351	0.220	0.108	FA8_HUMAN Coagulation factor VIII OS=Homo sapiens OX=9606 GN=F8 PE=1 SV=1
15	Q7TN96	2.39e-120	413	2258	0.221	0.113	Q7TN96_RAT Factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=2 SV=1
16	D3ZEB1	2.78e-120	413	2258	0.221	0.113	D3ZEB1_RAT Coagulation factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=3 SV=4
17	Q7SZN0	3.11e-119	404	1460	0.210	0.166	FA5V_PSETE Venom prothrombin activator pseutarin-C non-catalytic subunit OS=Pseudonaja textilis OX=8673 PE=1 SV=1
18	Q58L90	1.21e-117	400	1460	0.210	0.166	FA5V_OXYMI Venom prothrombin activator omicarin-C non-catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1
19	Q58L91	2.21e-115	393	1459	0.211	0.167	FA5V_OXYSU Venom prothrombin activator oscutarin-C non-catalytic subunit OS=Oxyuranus scutellatus OX=8668 PE=1 SV=1
20	P12259	1.87e-113	392	2224	0.208	0.108	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07731 Cu-oxidase_2	1.2e-17	75.4	Multicopper oxidase
2	PF07732 Cu-oxidase_3	2e-21	87.6	Multicopper oxidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430620

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261024	0.993	Solute carrier family 40 member 1
2	9606.ENSP00000216117	0.950	Heme oxygenase 1
3	9606.ENSP00000372326	0.948	Ferrochelatase, mitochondrial
4	9606.ENSP00000477572	0.930	Heme oxygenase 2
5	9606.ENSP00000366482	0.925	Frataxin, mitochondrial
6	9606.ENSP00000378364	0.897	Natural resistance-associated macrophage protein 2
7	9606.ENSP00000319141	0.880	Cytochrome b reductase 1
8	9606.ENSP00000471894	0.825	Hepcidin
9	9606.ENSP00000264613	0.816	Ceruloplasmin
10	9606.ENSP00000353224	0.775	Transferrin receptor protein 1
11	9606.ENSP00000420525	0.755	Transferrin receptor protein 2
12	9606.ENSP00000417404	0.716	Hereditary hemochromatosis protein
13	9606.ENSP00000376822	0.707	Metalloreductase STEAP3
14	9606.ENSP00000352779	0.699	Zinc transporter ZIP14
15	9606.ENSP00000337014	0.691	Hemojuvelin
16	9606.ENSP00000258229	0.689	Pecanex-like protein 2
17	9606.ENSP00000357612	0.686	Zinc transporter ZIP1
18	9606.ENSP00000345728	0.685	Copper-transporting ATPase 1
19	9606.ENSP00000430598	0.672	Copper transport protein ATOX1
20	9606.ENSP00000309477	0.671	Cytoplasmic aconitate hydratase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004322	1.000	ferroxidase activity
GO:0005507	1.000	copper ion binding
GO:0005506	0.998	iron ion binding
GO:0008198	0.887	ferrous iron binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0000041	0.987	transition metal ion transport
GO:0006826	0.973	iron ion transport
GO:0055072	0.397	iron ion homeostasis
GO:0030003	0.321	intracellular monoatomic cation homeostasis
GO:0065007	0.316	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0005886	0.989	plasma membrane
GO:0043227	0.959	membrane-bounded organelle
GO:0043231	0.951	intracellular membrane-bounded organelle
GO:0005576	0.843	extracellular region
GO:0005615	0.795	extracellular space
GO:0031090	0.572	organelle membrane
GO:0048471	0.350	perinuclear region of cytoplasm
GO:0016323	0.345	basolateral plasma membrane
GO:0031982	0.319	vesicle
GO:0098588	0.301	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11148	1.000	4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O
EC:1.16.3.1	1.000	ferroxidase.

[back to server]