StarFunc result for job id Q9BQS8

User Input

>input (1478 residues)
MASTNAESQLQRIIRDLQDAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQFDQKEK
ATLLGNKKDYWDYFCACLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLQPKLSSDIVGQLYELTEVQFDLASRGFDLDAAWPTFAR
RTLTTGSSAYLWKPPSRSSSMSSLVSSYLQTQEMVSNFDLNSPLNNEALEGFDEMRLELD
QLEVREKQLRERMQQLDRENQELRAAVSQQGEQLQTERERGRTAAEDNVRLTCLVAELQK
QWEVTQATQNTVKELQTCLQGLELGAAEKEEDYHTALRRLESMLQPLAQELEATRDSLDK
KNQHLASFPGWLAMAQQKADTASDTKGRQEPIPSDAAQEMQELGEKLQALERERTKVEEV
NRQQSAQLEQLVKELQLKEDARASLERLVKEMAPLQEELSGKGQEADQLWRRLQELLAHT
SSWEEELAELRREKKQQQEEKELLEQEVRSLTRQLQFLETQLAQVSQHVSDLEEQKKQLI
QDKDHLSQQVGMLERLAGPPGPELPVAGEKNEALVPVNSSLQEAWGKPEEEQRGLQEAQL
DDTKVQEGSQEEELRQANRELEKELQNVVGRNQLLEGKLQALQADYQALQQRESAIQGSL
ASLEAEQASIRHLGDQMEASLLAVRKAKEAMKAQMAEKEAILQSKEGECQQLREEVEQCQ
QLAEARHRELRALESQCQQQTQLIEVLTAEKGQQGVGPPTDNEARELAAQLALSQAQLEV
HQGEVQRLQAQVVDLQAKMRAALDDQDKVQSQLSMAEAVLREHKTLVQQLKEQNEALNRA
HVQELLQCSEREGALQEERADEAQQREEELRALQEELSQAKCSSEEAQLEHAELQEQLHR
ANTDTAELGIQVCALTVEKERVEEALACAVQELQDAKEAASREREGLERQVAGLQQEKES
LQEKLKAAKAAAGSLPGLQAQLAQAEQRAQSLQEAAHQELNTLKFQLSAEIMDYQSRLKN
AGEECKSLRGQLEEQGRQLQAAEEAVEKLKATQADMGEKLSCTSNHLAECQAAMLRKDKE
GAALREDLERTQKELEKATTKIQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEER
LIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFSWMVRRHHCRICGR
IFCYYCCNNYVLSKHGGKKERCCRACFQKLSEGPGSPDSSGSGTSQGEPSPALSPASPGP
QATGGQGANTDYRPPDDAVFDIITDEELCQIQESGSSLPETPTETDSLDPNAAEQDTTST
SLTPEDTEDMPVGQDSEICLLKSGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIPIT
VAEAGLTISWVFSSDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRT
PGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSDFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQS8	1.000	1.000	0.000	1478	1.000	1.000	Q9BQS8.pdb.gz	FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3
2	AFDB:Q3TYX8	0.117	0.303	2.675E-15	563	0.054	0.142	Q3TYX8.pdb.gz	RUFY4_MOUSE RUN and FYVE domain-containing protein 4 OS=Mus musculus OX=10090 GN=Rufy4 PE=2 SV=3
3	AFDB:Q6ZNE9	0.120	0.305	2.985E-15	571	0.054	0.140	Q6ZNE9.pdb.gz	RUFY4_HUMAN RUN and FYVE domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RUFY4 PE=1 SV=2
4	AFDB:Q8BIJ7	0.112	0.229	1.242E-11	712	0.074	0.153	Q8BIJ7.pdb.gz	RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rufy1 PE=1 SV=1
5	AFDB:A0A0B4LHR2	0.116	0.206	2.675E-11	815	0.074	0.135	A0A0B4LHR2.pdb.gz	A0A0B4LHR2_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=CG6001 PE=4 SV=1
6	AFDB:Q8IMP0	0.116	0.193	3.153E-11	862	0.072	0.124	Q8IMP0.pdb.gz	Q8IMP0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=RUFY1 PE=4 SV=1
7	AFDB:Q8IMP1	0.114	0.247	7.176E-11	667	0.074	0.163	Q8IMP1.pdb.gz	Q8IMP1_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
8	AFDB:Q8IMP2	0.111	0.223	7.580E-11	729	0.071	0.144	Q8IMP2.pdb.gz	Q8IMP2_DROME LD28220p OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
9	AFDB:A0A0B4LHR8	0.119	0.183	8.007E-11	877	0.070	0.119	A0A0B4LHR8.pdb.gz	A0A0B4LHR8_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
10	AFDB:Q5FVJ0	0.107	0.329	2.148E-10	469	0.063	0.198	Q5FVJ0.pdb.gz	RUFY3_RAT Protein RUFY3 OS=Rattus norvegicus OX=10116 GN=Rufy3 PE=1 SV=1
11	PDB:1olmE	0.069	0.250	3.297E-10	397	0.019	0.071	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
12	PDB:4tlgA	0.069	0.248	6.365E-10	396	0.020	0.073	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
13	PDB:4uybA	0.068	0.244	6.026E-9	401	0.020	0.072	4uybA.pdb.gz
14	PDB:3am2A	0.066	0.284	2.506E-4	286	0.008	0.042	3am2A.pdb.gz
15	PDB:4dxzA	0.059	0.498	2.797E-4	111	0.014	0.180	4dxzA.pdb.gz
16	PDB:3lxuX	0.067	0.080	4.839E-4	1217	0.012	0.014	3lxuX.pdb.gz
17	PDB:7chjB	0.047	0.206	1.616E-3	226	0.011	0.071	7chjB.pdb.gz	Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.
18	PDB:1kfuL	0.054	0.106	6.365E-3	699	0.012	0.026	1kfuL.pdb.gz
19	PDB:2c0zA	0.054	0.316	7.503E-3	199	0.012	0.085	2c0zA.pdb.gz
20	PDB:2e31A	0.058	0.276	1.449E-2	246	0.006	0.037	2e31A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BQS8	0.0	2994	1478	1.000	1.000	FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3
2	H7BZ74	5.20e-180	537	267	0.180	0.996	H7BZ74_HUMAN FYVE and coiled-coil domain autophagy adaptor 1 (Fragment) OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=1
3	C9J2W6	1.08e-99	317	149	0.101	1.000	C9J2W6_HUMAN FYVE and coiled-coil domain autophagy adaptor 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=1
4	Q6ZNE9	1.21e-43	171	571	0.053	0.137	RUFY4_HUMAN RUN and FYVE domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RUFY4 PE=1 SV=2
5	Q3TYX8	5.03e-39	156	563	0.049	0.130	RUFY4_MOUSE RUN and FYVE domain-containing protein 4 OS=Mus musculus OX=10090 GN=Rufy4 PE=2 SV=3
6	A0A0G2K051	6.13e-13	76.6	1407	0.024	0.025	A0A0G2K051_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=2
7	Q15075	6.34e-13	76.6	1411	0.024	0.025	EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2
8	Q8BL66	6.56e-13	76.6	1411	0.020	0.021	EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus OX=10090 GN=Eea1 PE=1 SV=2
9	A0A8I5ZV67	6.85e-13	76.3	1411	0.024	0.025	A0A8I5ZV67_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=4 SV=1
10	A0A8I6A8E0	7.94e-13	76.3	1431	0.024	0.024	A0A8I6A8E0_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=1
11	F1LUA1	8.03e-13	76.3	1450	0.024	0.024	F1LUA1_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=2
12	A0A8I6AIH5	8.34e-13	76.3	1312	0.024	0.027	A0A8I6AIH5_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=1
13	A0A8I6AIN6	8.53e-13	76.3	1453	0.024	0.024	A0A8I6AIN6_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=1
14	Q5FC45	1.40e-12	75.5	1203	0.017	0.021	Q5FC45_CAEEL FYVE-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eea-1 PE=1 SV=1
15	G5ED80	1.45e-12	75.5	1205	0.017	0.021	G5ED80_CAEEL EEA1 OS=Caenorhabditis elegans OX=6239 GN=eea-1 PE=1 SV=1
16	Q7Z3T8	1.45e-12	75.5	1539	0.017	0.016	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
17	Q06651	1.84e-10	65.9	286	0.022	0.115	PIB1_YEAST E3 ubiquitin-protein ligase PIB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIB1 PE=1 SV=1
18	Q8WXA3	1.96e-10	67.8	606	0.018	0.045	RUFY2_HUMAN RUN and FYVE domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RUFY2 PE=1 SV=3
19	Q8BIJ7	7.75e-10	65.9	712	0.018	0.037	RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rufy1 PE=1 SV=1
20	Q86P45	1.20e-09	64.7	441	0.018	0.061	Q86P45_DROME SD23787p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG6001 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	8.4e-13	59.6	FYVE zinc finger
2	PF13897 GOLD_2	0.003	29.5	Golgi-dynamics membrane-trafficking
3	PF04849 HAP1_N	16	16.2	HAP1 N-terminal conserved region
4	PF02759 RUN	2e-06	39.4	RUN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296137

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479762	0.997	Ras-related protein Rab-7b
2	9606.ENSP00000265062	0.993	Ras-related protein Rab-7a
3	9606.ENSP00000268607	0.966	Microtubule-associated proteins 1A/1B light chain 3B
4	9606.ENSP00000363970	0.955	Microtubule-associated proteins 1A/1B light chain 3A
5	9606.ENSP00000377282	0.863	Protrudin
6	9606.ENSP00000395704	0.823	C-X-C chemokine receptor type 6
7	9606.ENSP00000218249	0.818	Ras-related protein Rab-40A-like
8	9606.ENSP00000037243	0.806	Gamma-aminobutyric acid receptor-associated protein-like 2
9	9606.ENSP00000287482	0.736	Spindle assembly abnormal protein 6 homolog
10	9606.ENSP00000314544	0.727	CCZ1 homolog B, vacuolar protein trafficking and biogenesis associated
11	9606.ENSP00000266458	0.689	Gamma-aminobutyric acid receptor-associated protein-like 1
12	9606.ENSP00000470152	0.676	Dystrobrevin alpha
13	9606.ENSP00000306866	0.645	Gamma-aminobutyric acid receptor-associated protein
14	9606.ENSP00000342699	0.642	Cilia- and flagella-associated protein 36
15	9606.ENSP00000325681	0.639	CCZ1 homolog, vacuolar protein trafficking and biogenesis associated
16	9606.ENSP00000389913	0.635	Pleckstrin homology domain-containing family M member 1
17	9606.ENSP00000262039	0.626	Phosphatidylinositol 3-kinase catalytic subunit type 3
18	9606.ENSP00000411250	0.618	Next to BRCA1 gene 1 protein
19	9606.ENSP00000301336	0.612	Rab-interacting lysosomal protein
20	9606.ENSP00000329507	0.601	CMRF35-like molecule 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.424	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048518	0.967	positive regulation of biological process
GO:0051641	0.959	cellular localization
GO:0051128	0.958	regulation of cellular component organization
GO:0051234	0.957	establishment of localization
GO:0048522	0.955	positive regulation of cellular process
GO:0006810	0.948	transport
GO:0019222	0.936	regulation of metabolic process
GO:0031323	0.926	regulation of cellular metabolic process
GO:0046907	0.893	intracellular transport
GO:0009894	0.828	regulation of catabolic process
GO:0009893	0.694	positive regulation of metabolic process
GO:0010506	0.628	regulation of autophagy
GO:0051640	0.586	organelle localization
GO:0016241	0.533	regulation of macroautophagy
GO:0009896	0.483	positive regulation of catabolic process
GO:0031325	0.450	positive regulation of cellular metabolic process
GO:0033043	0.427	regulation of organelle organization
GO:0071840	0.425	cellular component organization or biogenesis
GO:0051656	0.424	establishment of organelle localization
GO:0010508	0.418	positive regulation of autophagy
GO:0016043	0.381	cellular component organization
GO:0007017	0.354	microtubule-based process
GO:0051130	0.351	positive regulation of cellular component organization
GO:0051648	0.346	vesicle localization
GO:0007018	0.342	microtubule-based movement
GO:0008152	0.340	metabolic process
GO:0099111	0.335	microtubule-based transport
GO:0047496	0.332	vesicle transport along microtubule
GO:0016239	0.331	positive regulation of macroautophagy
GO:0043244	0.327	regulation of protein-containing complex disassembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.998	endomembrane system
GO:0031982	0.998	vesicle
GO:0005773	0.997	vacuole
GO:0005764	0.992	lysosome
GO:0005776	0.991	autophagosome
GO:0005768	0.991	endosome
GO:0005794	0.984	Golgi apparatus
GO:0005770	0.983	late endosome
GO:0005829	0.929	cytosol
GO:0031090	0.850	organelle membrane
GO:0098588	0.804	bounding membrane of organelle
GO:0005774	0.716	vacuolar membrane
GO:0043232	0.559	intracellular non-membrane-bounded organelle
GO:0031981	0.493	nuclear lumen
GO:0005654	0.309	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]