StarFunc result for job id Q9BQT8

User Input

>input (299 residues)
MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSF
RMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSG
LTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHG
VFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQP
VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BQT8	1.000	1.000	8.090E-40	299	1.000	1.000	Q9BQT8.pdb.gz	ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A21 PE=1 SV=1
2	AFDB:Q8BZ09	0.975	0.978	4.393E-34	298	0.813	0.815	Q8BZ09.pdb.gz	ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus OX=10090 GN=Slc25a21 PE=1 SV=1
3	AFDB:Q99297	0.890	0.868	1.308E-17	307	0.358	0.349	Q99297.pdb.gz	ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ODC2 PE=1 SV=1
4	AFDB:Q03028	0.863	0.834	2.013E-16	310	0.355	0.342	Q03028.pdb.gz	ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ODC1 PE=1 SV=1
5	AFDB:O43772	0.826	0.821	4.765E-14	301	0.288	0.286	O43772.pdb.gz	MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens OX=9606 GN=SLC25A20 PE=1 SV=1
6	AFDB:Q84UC7	0.826	0.796	5.183E-14	311	0.268	0.257	Q84UC7.pdb.gz	BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana OX=3702 GN=BAC1 PE=1 SV=1
7	AFDB:Q9VGF7	0.812	0.761	6.957E-14	321	0.298	0.277	Q9VGF7.pdb.gz	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
8	AFDB:Q9FI73	0.794	0.707	7.892E-14	339	0.304	0.268	Q9FI73.pdb.gz	TDPC2_ARATH Mitochondrial thiamine diphosphate carrier 2 OS=Arabidopsis thaliana OX=3702 GN=At5g48970 PE=2 SV=1
9	AFDB:P39953	0.821	0.740	1.016E-13	335	0.254	0.227	P39953.pdb.gz	YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEA6 PE=1 SV=1
10	AFDB:A0A1D8PNY6	0.793	0.784	1.105E-13	303	0.314	0.310	A0A1D8PNY6.pdb.gz	A0A1D8PNY6_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SFC1 PE=3 SV=1
11	PDB:2c3eA	0.795	0.810	4.164E-10	293	0.217	0.222	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
12	PDB:4c9qB	0.748	0.769	1.107E-8	290	0.201	0.207	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:6gciA	0.577	0.588	8.072E-7	292	0.204	0.209	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:2bb6A	0.171	0.137	1.738E-1	414	0.130	0.094	2bb6A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
15	PDB:7jr7B	0.153	0.100	2.056E-1	579	0.107	0.055	7jr7B.pdb.gz
16	PDB:4f4cA	0.167	0.053	2.333E-1	1250	0.130	0.031	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
17	PDB:7p5cA	0.150	0.127	3.705E-1	392	0.124	0.094	7p5cA.pdb.gz
18	PDB:7oseB	0.188	0.167	5.884E-1	377	0.110	0.088	7oseB.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
19	PDB:4ntiA	0.171	0.224	6.137E-1	202	0.074	0.109	4ntiA.pdb.gz	Arabidopsis Accelerated Cell Death 11, ACD11, Is a Ceramide-1-Phosphate Transfer Protein and Intermediary Regulator of Phytoceramide Levels.
20	PDB:7p54A	0.136	0.109	6.137E-1	397	0.140	0.106	7p54A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BZ09	0.0	508	298	0.813	0.815	ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus OX=10090 GN=Slc25a21 PE=1 SV=1
2	Q9BQT8	0.0	612	299	1.000	1.000	ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens OX=9606 GN=SLC25A21 PE=1 SV=1
3	Q99297	5.89e-59	192	307	0.361	0.352	ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ODC2 PE=1 SV=1
4	Q03028	7.86e-49	166	310	0.371	0.358	ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ODC1 PE=1 SV=1
5	P33303	6.32e-45	157	322	0.371	0.345	SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFC1 PE=1 SV=2
6	G8B6G7	1.58e-43	153	318	0.351	0.330	G8B6G7_CANPC Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=SFC1 PE=3 SV=1
7	C8VCR9	6.87e-41	146	323	0.331	0.307	C8VCR9_EMENI Mitochondrial succinate-fumarate antiporter (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07287 PE=3 SV=1
8	A0A1D8PNY6	7.27e-41	145	303	0.328	0.323	A0A1D8PNY6_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SFC1 PE=3 SV=1
9	Q12482	1.52e-33	132	902	0.298	0.099	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
10	Q9M038	2.01e-33	126	309	0.311	0.301	SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=SFC1 PE=2 SV=1
11	Q8INJ3	8.93e-33	124	319	0.314	0.295	Q8INJ3_DROME AT03939p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
12	P79110	6.56e-31	119	311	0.298	0.286	TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus OX=9913 GN=SLC25A1 PE=1 SV=1
13	Q6PGY3	8.80e-31	120	359	0.301	0.251	TXTPA_DANRE Tricarboxylate transport protein A, mitochondrial OS=Danio rerio OX=7955 GN=slc25a1a PE=2 SV=1
14	Q9VGF7	1.76e-30	119	321	0.294	0.274	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
15	Q9FI73	5.26e-30	117	339	0.318	0.280	TDPC2_ARATH Mitochondrial thiamine diphosphate carrier 2 OS=Arabidopsis thaliana OX=3702 GN=At5g48970 PE=2 SV=1
16	Q9UJS0	1.26e-29	120	675	0.311	0.138	S2513_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2
17	Q9VWG0	1.94e-29	117	387	0.278	0.214	SHAWN_DROME Solute carrier family 25 protein Shawn OS=Drosophila melanogaster OX=7227 GN=Shawn PE=1 SV=2
18	Q9QXX4	7.87e-29	118	676	0.308	0.136	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
19	Q9H1K4	8.51e-28	111	315	0.278	0.263	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
20	B4FIJ0	1.39e-27	111	336	0.314	0.280	TDPC1_MAIZE Mitochondrial thiamine diphosphate carrier 1 OS=Zea mays OX=4577 GN=GRMZM2G118515 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	3.1e-58	205.0	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329452

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386170	0.734	T-box transcription factor TBX20
2	9606.ENSP00000355245	0.713	Paired box protein Pax-9
3	9606.ENSP00000454562	0.690	Deoxyribonuclease-1-like 2
4	9606.ENSP00000333539	0.633	Mirror-image polydactyly 1
5	9606.ENSP00000461324	0.585	Involved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane
6	9606.ENSP00000315017	0.573	Mitochondrial ribosomal protein L1
7	9606.ENSP00000216254	0.562	Aconitate hydratase, mitochondrial
8	9606.ENSP00000299697	0.553	Thymidine kinase 2, mitochondrial
9	9606.ENSP00000381499	0.536	Paired box protein Pax-1
10	9606.ENSP00000256339	0.517	Protein unc-79 homolog
11	9606.ENSP00000479773	0.513	Cilia and flagella associated protein 57

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005310	0.995	dicarboxylic acid transmembrane transporter activity
GO:0005488	0.915	binding
GO:0005515	0.713	protein binding
GO:1901702	0.455	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044237	0.936	cellular metabolic process
GO:0071702	0.936	organic substance transport
GO:0015849	0.932	organic acid transport
GO:0055085	0.921	transmembrane transport
GO:0015711	0.811	organic anion transport
GO:0044238	0.810	primary metabolic process
GO:0006807	0.694	nitrogen compound metabolic process
GO:0046942	0.641	carboxylic acid transport
GO:0044281	0.590	small molecule metabolic process
GO:1990542	0.566	mitochondrial transmembrane transport
GO:0006082	0.477	organic acid metabolic process
GO:1905039	0.453	carboxylic acid transmembrane transport
GO:1901564	0.420	organonitrogen compound metabolic process
GO:0043436	0.419	oxoacid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.959	membrane
GO:0031090	0.933	organelle membrane
GO:0031975	0.886	envelope
GO:0031967	0.877	organelle envelope
GO:0005740	0.863	mitochondrial envelope
GO:0031966	0.761	mitochondrial membrane
GO:0070013	0.713	intracellular organelle lumen
GO:0019866	0.686	organelle inner membrane
GO:0005743	0.389	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]