StarFunc result for job id Q9BQY4

User Input

>input (288 residues)
MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKL
KSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSR
PQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQI
WFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSS
SLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C7M4	0.489	0.489	4.314E-39	288	0.993	0.993	P0C7M4.pdb.gz	RHF2B_HUMAN Rhox homeobox family member 2B OS=Homo sapiens OX=9606 GN=RHOXF2B PE=1 SV=1
2	AFDB:Q9Z2U3	0.283	0.217	4.650E-11	387	0.326	0.243	Q9Z2U3.pdb.gz	Q9Z2U3_MOUSE Homeodomain protein EPX (Fragment) OS=Mus musculus OX=10090 GN=Esx1 PE=2 SV=1
3	AFDB:Q8N693	0.252	0.182	3.989E-10	406	0.299	0.212	Q8N693.pdb.gz	ESX1_HUMAN Homeobox protein ESX1 OS=Homo sapiens OX=9606 GN=ESX1 PE=1 SV=3
4	AFDB:O60902	0.227	0.199	8.326E-8	331	0.243	0.211	O60902.pdb.gz	SHOX2_HUMAN Short stature homeobox protein 2 OS=Homo sapiens OX=9606 GN=SHOX2 PE=1 SV=4
5	AFDB:O35602	0.247	0.210	1.153E-7	342	0.260	0.219	O35602.pdb.gz	RX_MOUSE Retinal homeobox protein Rx OS=Mus musculus OX=10090 GN=Rax PE=2 SV=2
6	AFDB:Q6P295	0.243	0.282	1.314E-7	245	0.229	0.269	Q6P295.pdb.gz	Q6P295_DANRE Paired mesoderm homeobox protein 1 OS=Danio rerio OX=7955 GN=fa97b09 PE=2 SV=1
7	AFDB:P54821	0.255	0.297	1.704E-7	245	0.226	0.265	P54821.pdb.gz	PRRX1_HUMAN Paired mesoderm homeobox protein 1 OS=Homo sapiens OX=9606 GN=PRRX1 PE=1 SV=2
8	AFDB:B0JZM4	0.245	0.285	6.271E-7	245	0.191	0.224	B0JZM4.pdb.gz
9	AFDB:Q7T373	0.256	0.297	7.144E-7	245	0.240	0.282	Q7T373.pdb.gz	Q7T373_DANRE Paired related homeobox 1 OS=Danio rerio OX=7955 GN=prrx1 PE=2 SV=1
10	AFDB:Q99811	0.262	0.297	1.056E-6	253	0.194	0.221	Q99811.pdb.gz	PRRX2_HUMAN Paired mesoderm homeobox protein 2 OS=Homo sapiens OX=9606 GN=PRRX2 PE=2 SV=2
11	PDB:4egcA	0.176	0.094	1.960E-2	539	0.049	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.182	0.629	4.282E-2	73	0.073	0.288	2hi3A.pdb.gz
13	PDB:5mrca	0.124	0.192	1.266	177	0.056	0.090	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
14	PDB:7dcoL	0.131	0.088	1.540	435	0.069	0.046	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
15	PDB:7fbyA	0.129	0.223	1.643	153	0.038	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:7ml4M	0.124	0.147	2.132	234	0.028	0.034	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
17	PDB:3ndbB	0.135	0.095	2.767	420	0.031	0.021	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
18	PDB:2ffhA	0.135	0.101	3.364	407	0.038	0.027	2ffhA.pdb.gz
19	PDB:5lzbz	0.117	0.059	4.090	614	0.035	0.016	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
20	PDB:2w96A	0.137	0.156	4.973	249	0.028	0.032	2w96A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C7M4	0.0	581	288	0.993	0.993	RHF2B_HUMAN Rhox homeobox family member 2B OS=Homo sapiens OX=9606 GN=RHOXF2B PE=1 SV=1
2	Q9BQY4	0.0	585	288	1.000	1.000	RHXF2_HUMAN Rhox homeobox family member 2 OS=Homo sapiens OX=9606 GN=RHOXF2 PE=1 SV=1
3	Q8N693	7.27e-21	93.6	406	0.264	0.187	ESX1_HUMAN Homeobox protein ESX1 OS=Homo sapiens OX=9606 GN=ESX1 PE=1 SV=3
4	P54821	1.45e-16	79.3	245	0.156	0.184	PRRX1_HUMAN Paired mesoderm homeobox protein 1 OS=Homo sapiens OX=9606 GN=PRRX1 PE=1 SV=2
5	P63013	1.51e-16	79.3	245	0.156	0.184	PRRX1_MOUSE Paired mesoderm homeobox protein 1 OS=Mus musculus OX=10090 GN=Prrx1 PE=1 SV=1
6	P63014	1.51e-16	79.3	245	0.156	0.184	PRRX1_RAT Paired mesoderm homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Prrx1 PE=1 SV=1
7	G3V2N3	1.53e-16	78.2	200	0.156	0.225	G3V2N3_HUMAN Paired related homeobox 1 OS=Homo sapiens OX=9606 GN=PRRX1 PE=1 SV=1
8	Q6P295	2.49e-16	78.6	245	0.125	0.147	Q6P295_DANRE Paired mesoderm homeobox protein 1 OS=Danio rerio OX=7955 GN=fa97b09 PE=2 SV=1
9	Q7T373	2.51e-16	78.6	245	0.125	0.147	Q7T373_DANRE Paired related homeobox 1 OS=Danio rerio OX=7955 GN=prrx1 PE=2 SV=1
10	Q99811	7.18e-16	77.4	253	0.122	0.138	PRRX2_HUMAN Paired mesoderm homeobox protein 2 OS=Homo sapiens OX=9606 GN=PRRX2 PE=2 SV=2
11	Q06348	7.32e-16	77.4	247	0.122	0.142	PRRX2_MOUSE Paired mesoderm homeobox protein 2 OS=Mus musculus OX=10090 GN=Prrx2 PE=2 SV=2
12	A0A1W2PRU4	7.81e-15	74.7	263	0.194	0.213	A0A1W2PRU4_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
13	A0A1W2PP27	8.04e-15	74.7	260	0.194	0.215	A0A1W2PP27_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
14	A0A1W2PNS7	9.00e-15	74.7	281	0.194	0.199	A0A1W2PNS7_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
15	A0A1W2PQ31	1.02e-14	74.7	277	0.194	0.202	A0A1W2PQ31_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
16	A0A1W2PPJ2	1.04e-14	74.7	282	0.194	0.199	A0A1W2PPJ2_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
17	O42356	1.19e-14	75.1	330	0.122	0.106	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
18	A0A1W2PPH0	1.20e-14	74.7	283	0.194	0.198	A0A1W2PPH0_HUMAN Paired box 6 (Fragment) OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
19	A0A1W2PRA8	1.29e-14	74.3	286	0.194	0.196	A0A1W2PRA8_HUMAN Paired box 6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
20	Q8T0V5	1.52e-14	75.1	357	0.104	0.084	Q8T0V5_DROME GH01528p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	4.4e-13	60.2	Homeodomain
2	PF04034 Ribo_biogen_C	6.6e+02	11.4	Ribosome biogenesis protein, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314733	0.733	Toll-interacting protein
2	9606.ENSP00000376035	0.722	Zinc finger and BTB domain-containing protein 32
3	9606.ENSP00000406022	0.711	Netrin receptor UNC5C
4	9606.ENSP00000344095	0.669	Tissue-resident T-cell transcription regulator protein ZNF683
5	9606.ENSP00000448051	0.663	DAZ associated protein 2
6	9606.ENSP00000351327	0.650	A-kinase anchor protein 4
7	9606.ENSP00000453704	0.648	Homeobox protein TGIF2LX
8	9606.ENSP00000331086	0.600	Outer dense fiber protein 4
9	9606.ENSP00000384474	0.584	Huntingtin-interacting protein K
10	9606.ENSP00000323455	0.579	Tetra-peptide repeat homeobox protein 1
11	9606.ENSP00000335578	0.509	Arginine-fifty homeobox
12	9606.ENSP00000380053	0.504	PRD class homeoboxes and pseudogenes

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0005515	0.998	protein binding
GO:0042802	0.994	identical protein binding
GO:0003700	0.980	DNA-binding transcription factor activity
GO:0000981	0.955	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.827	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0010468	0.994	regulation of gene expression
GO:0048518	0.965	positive regulation of biological process
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0010628	0.633	positive regulation of gene expression
GO:0050794	0.615	regulation of cellular process
GO:0009987	0.450	cellular process
GO:0048519	0.362	negative regulation of biological process
GO:0048523	0.343	negative regulation of cellular process
GO:0051171	0.325	regulation of nitrogen compound metabolic process
GO:0080090	0.323	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043233	0.970	organelle lumen
GO:0005737	0.967	cytoplasm
GO:0070013	0.935	intracellular organelle lumen
GO:0031981	0.863	nuclear lumen
GO:0005654	0.733	nucleoplasm
GO:0005829	0.343	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]