StarFunc result for job id Q9BR26

User Input

>input (566 residues)
MPGHPGAAEQLVKTGWRSWHLGFWKALAPLQAAWDAFSQPVPASCGQLLTQLLLCASLAA
AAAGLVYHWLASLLLYPPGPSAMVATVCGLLVFLSLGLVPPVRCLFALSVPTLGMEQGRR
LLLSYSTATLAIAVVPNVLANVGAAGQVLRCVTEGSLESLLNTTHQLHAASRALGPTGQA
GSRGLTFEAQDNGSAFYLHMLRVTQQVLEDFSGLESLARAAALGTQRVVTGLFMLGLLVE
SAWYLHCYLTDLRFDNIYATQQLTQRLAQAQATHLLAPPPTWLLQAAQLRLSQEELLSCL
LRLGLLALLLVATAVAVATDHVAFLLAQATVDWAQKLPTVPITLTVKYDVAYTVLGFIPF
LFNQLAPESPFLSVHSSYQWELRLTSARCPLLPARRPRAAAPLAAGALQLLAGSTVLLEA
YARRLRHAIAASFFTAQEARRVRHLHARLQRRHDRHQGQQLPLGDPSCVPTPRPACKPPA
WIDYRLDALRTESSEGEGKELWSCRDLSCNLGPVPPPCVTLGKSLHLSEPRFLHLHNDSI
FTIDVTYFPRRDVVRMEGNTGHDRPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D611	0.727	0.820	1.898E-48	498	0.583	0.663	Q9D611.pdb.gz	OCSTP_MOUSE Osteoclast stimulatory transmembrane protein OS=Mus musculus OX=10090 GN=Ocstamp PE=1 SV=1
2	AFDB:Q5T197	0.457	0.375	1.102E-11	706	0.159	0.127	Q5T197.pdb.gz	DCST1_HUMAN E3 ubiquitin-protein ligase DCST1 OS=Homo sapiens OX=9606 GN=DCST1 PE=1 SV=1
3	AFDB:Q059Y8	0.425	0.340	7.743E-11	732	0.125	0.097	Q059Y8.pdb.gz	DCST1_MOUSE E3 ubiquitin-protein ligase DCST1 OS=Mus musculus OX=10090 GN=Dcst1 PE=1 SV=1
4	AFDB:A0A140LIJ0	0.465	0.387	1.580E-10	701	0.159	0.128	A0A140LIJ0.pdb.gz	DCST2_MOUSE DC-STAMP domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcst2 PE=1 SV=1
5	AFDB:Q57U18	0.141	0.198	9.937E-2	382	0.087	0.128	Q57U18.pdb.gz	Q57U18_TRYB2 Trypanosoma glutamic acid/alanine-rich protein domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.8P12.560 PE=4 SV=1
6	AFDB:Q9QZA2	0.141	0.098	1.677E-1	873	0.113	0.073	Q9QZA2.pdb.gz	PDC6I_RAT Programmed cell death 6-interacting protein OS=Rattus norvegicus OX=10116 GN=Pdcd6ip PE=1 SV=2
7	AFDB:Q9HV55	0.063	0.047	2.230E-1	840	0.072	0.049	Q9HV55.pdb.gz	IF2_PSEAE Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=infB PE=1 SV=1
8	AFDB:F1RCQ6	0.092	0.100	3.422E-1	509	0.094	0.104	F1RCQ6.pdb.gz	F1RCQ6_DANRE Glucagon receptor b OS=Danio rerio OX=7955 GN=gcgrb PE=4 SV=2
9	PDB:7p5cA	0.102	0.142	3.554E-1	392	0.101	0.145	7p5cA.pdb.gz
10	PDB:6x15A	0.077	0.097	3.909E-1	419	0.092	0.124	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
11	AFDB:Q581F2	0.077	0.101	3.946E-1	403	0.104	0.146	Q581F2.pdb.gz	Q581F2_TRYB2 Haptoglobin-hemoglobin receptor OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28F21.220 PE=1 SV=1
12	PDB:7p5jA	0.117	0.155	4.099E-1	399	0.110	0.155	7p5jA.pdb.gz
13	PDB:7xr4A	0.071	0.091	4.099E-1	425	0.129	0.172	7xr4A.pdb.gz	Structural basis of ligand binding modes of human EAAT2.
14	PDB:7p54A	0.141	0.188	4.958E-1	397	0.085	0.121	7p54A.pdb.gz
15	AFDB:B1AWN6	0.073	0.027	6.055E-1	2006	0.102	0.029	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
16	PDB:7kgbc	0.035	0.083	2.271	207	0.016	0.043	7kgbc.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
17	PDB:5d80G	0.072	0.141	3.323	223	0.049	0.126	5d80G.pdb.gz
18	PDB:7lb8B	0.080	0.073	3.323	630	0.067	0.060	7lb8B.pdb.gz
19	PDB:5u1dA	0.113	0.114	4.019	561	0.085	0.086	5u1dA.pdb.gz
20	PDB:6vq6H	0.082	0.175	4.019	214	0.035	0.093	6vq6H.pdb.gz	Structure of V-ATPase from the mammalian brain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D611	0.0	533	498	0.576	0.655	OCSTP_MOUSE Osteoclast stimulatory transmembrane protein OS=Mus musculus OX=10090 GN=Ocstamp PE=1 SV=1
2	A0A140LIJ0	2.07e-06	53.1	701	0.101	0.081	DCST2_MOUSE DC-STAMP domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcst2 PE=1 SV=1
3	Q9VU52	0.002	43.9	715	0.102	0.081	SNKY_DROME Protein sneaky OS=Drosophila melanogaster OX=7227 GN=snky PE=2 SV=3
4	Q9H295	0.008	41.2	470	0.150	0.181	DCSTP_HUMAN Dendritic cell-specific transmembrane protein OS=Homo sapiens OX=9606 GN=DCSTAMP PE=1 SV=1
5	D3ZVC2	0.29	36.2	470	0.092	0.111	D3ZVC2_RAT Dendrocyte expressed seven transmembrane protein OS=Rattus norvegicus OX=10116 GN=Dcstamp PE=4 SV=3
6	Q7TNJ0	0.57	35.4	470	0.170	0.204	DCSTP_MOUSE Dendritic cell-specific transmembrane protein OS=Mus musculus OX=10090 GN=Dcstamp PE=1 SV=1
7	Q059Y8	1.4	34.3	732	0.046	0.036	DCST1_MOUSE E3 ubiquitin-protein ligase DCST1 OS=Mus musculus OX=10090 GN=Dcst1 PE=1 SV=1
8	Q5T197	1.9	33.9	706	0.032	0.025	DCST1_HUMAN E3 ubiquitin-protein ligase DCST1 OS=Homo sapiens OX=9606 GN=DCST1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07782 DC_STAMP	9.6e-36	134.9	DC-STAMP-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000279028

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297581	0.950	Dendritic cell-specific transmembrane protein
2	9606.ENSP00000271651	0.771	Cathepsin K
3	9606.ENSP00000285393	0.746	V-type proton ATPase subunit d 2
4	9606.ENSP00000389377	0.730	Nuclear factor of activated T-cells, cytoplasmic 1
5	9606.ENSP00000468767	0.690	Tartrate-resistant acid phosphatase type 5
6	9606.ENSP00000381775	0.683	Tumor necrosis factor ligand superfamily member 11
7	9606.ENSP00000308208	0.659	Matrix metalloproteinase-14
8	9606.ENSP00000479089	0.623	Osteoclast-associated immunoglobulin-like receptor
9	9606.ENSP00000354733	0.574	Protein strawberry notch homolog 2
10	9606.ENSP00000246115	0.572	Sphingosine 1-phosphate receptor 4
11	9606.ENSP00000328472	0.555	Sphingosine 1-phosphate receptor 5
12	9606.ENSP00000414904	0.535	Cathepsin O
13	9606.ENSP00000352561	0.501	Calcitonin receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	0.946	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0051716	0.990	cellular response to stimulus
GO:0048522	0.986	positive regulation of cellular process
GO:0042221	0.985	response to chemical
GO:0071310	0.978	cellular response to organic substance
GO:0048856	0.966	anatomical structure development
GO:0050793	0.964	regulation of developmental process
GO:0002682	0.959	regulation of immune system process
GO:0030154	0.955	cell differentiation
GO:0071345	0.904	cellular response to cytokine stimulus
GO:0009719	0.896	response to endogenous stimulus
GO:0051239	0.858	regulation of multicellular organismal process
GO:0045595	0.834	regulation of cell differentiation
GO:0042127	0.826	regulation of cell population proliferation
GO:0008284	0.791	positive regulation of cell population proliferation
GO:0030097	0.753	hemopoiesis
GO:0002573	0.645	myeloid leukocyte differentiation
GO:0002684	0.523	positive regulation of immune system process
GO:0030316	0.520	osteoclast differentiation
GO:0051240	0.499	positive regulation of multicellular organismal process
GO:0071495	0.486	cellular response to endogenous stimulus
GO:0009725	0.485	response to hormone
GO:0045639	0.470	positive regulation of myeloid cell differentiation
GO:0002761	0.469	regulation of myeloid leukocyte differentiation
GO:1902107	0.459	positive regulation of leukocyte differentiation
GO:0002763	0.448	positive regulation of myeloid leukocyte differentiation
GO:0051128	0.413	regulation of cellular component organization
GO:0043627	0.382	response to estrogen
GO:0045670	0.377	regulation of osteoclast differentiation
GO:0034612	0.343	response to tumor necrosis factor
GO:0070663	0.336	regulation of leukocyte proliferation
GO:0032870	0.329	cellular response to hormone stimulus
GO:0071356	0.312	cellular response to tumor necrosis factor
GO:0019222	0.307	regulation of metabolic process
GO:0051130	0.303	positive regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.995	endomembrane system
GO:0005886	0.989	plasma membrane
GO:0031090	0.967	organelle membrane
GO:0031982	0.798	vesicle
GO:0005783	0.705	endoplasmic reticulum
GO:0005634	0.698	nucleus
GO:0042175	0.574	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.560	endoplasmic reticulum membrane
GO:0005576	0.427	extracellular region
GO:0032991	0.333	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.946	Transferases.

[back to server]