StarFunc result for job id Q9BR39

User Input

>input (696 residues)
MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTF
EGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDGYGT
ETYADGGTYQGQFTNGMRHGYGVRQSVPYGMAVVVRSPLRTSLSSLRSEHSNGTVAPDSP
ASPASDGPALPSPAIPRGGFALSLLANAEAAARAPKGGGLFQRGALLGKLRRAESRTSVG
SQRSRVSFLKSDLSSGASDAASTASLGEAAEGADEAAPFEADIDATTTETYMGEWKNDKR
SGFGVSERSSGLRYEGEWLDNLRHGYGCTTLPDGHREEGKYRHNVLVKDTKRRMLQLKSN
KVRQKVEHSVEGAQRAAAIARQKAEIAASRTSHAKAKAEAAEQAALAANQESNIARTLAR
ELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGAGAAGLPQPPRESPQLHERETPRP
EGGSPSPAGTPPQPKRPRPGVSKDGLLSPGAWNGEPSGEGSRSVTPSEGAGRRSPARPAT
ERMAIEALQAPPAPSREPEVALYQGYHSYAVRTTPPEPPPFEDQPEPEVSGSESAPSSPA
TAPLQAPTLRGPEPARETPAKLEPKPIIPKAEPRAKARKTEARGLTKAGAKKKARKEAAL
AAEAEVEVEEVPNTILICMVILLNIGLAILFVHLLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BR39	1.000	1.000	0.000	696	1.000	1.000	Q9BR39.pdb.gz	JPH2_HUMAN Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2
2	AFDB:Q9ET78	0.615	0.615	3.442E-92	696	0.876	0.876	Q9ET78.pdb.gz	JPH2_MOUSE Junctophilin-2 OS=Mus musculus OX=10090 GN=Jph2 PE=1 SV=2
3	AFDB:Q9HDC5	0.574	0.603	5.027E-66	661	0.514	0.542	Q9HDC5.pdb.gz	JPH1_HUMAN Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2
4	AFDB:Q8WXH2	0.502	0.469	4.041E-58	748	0.499	0.464	Q8WXH2.pdb.gz	JPH3_HUMAN Junctophilin-3 OS=Homo sapiens OX=9606 GN=JPH3 PE=1 SV=2
5	AFDB:Q22667	0.478	0.446	3.730E-52	747	0.359	0.335	Q22667.pdb.gz	Q22667_CAEEL Junctophilin-1 OS=Caenorhabditis elegans OX=6239 GN=jph-1 PE=1 SV=2
6	AFDB:Q80WT0	0.469	0.517	1.883E-51	628	0.385	0.427	Q80WT0.pdb.gz	JPH4_MOUSE Junctophilin-4 OS=Mus musculus OX=10090 GN=Jph4 PE=2 SV=1
7	PDB:7dmpA	0.194	0.690	7.612E-9	186	0.062	0.231	7dmpA.pdb.gz
8	PDB:6jleA	0.140	0.587	2.565E-7	144	0.050	0.243	6jleA.pdb.gz
9	AFDB:Q8JIG3	0.054	0.046	1.428E-1	845	0.106	0.088	Q8JIG3.pdb.gz	Q8JIG3_DANRE BHLH-PAS transcription factor OS=Danio rerio OX=7955 GN=zfCLOCK2 PE=2 SV=1
10	PDB:7mqaLW	0.072	0.098	1.515E-1	452	0.034	0.053	7mqaLW.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	AFDB:Q03213	0.067	0.066	2.233E-1	719	0.105	0.102	Q03213.pdb.gz	HOT1_YEAST High-osmolarity-induced transcription protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOT1 PE=1 SV=1
12	AFDB:O94842	0.047	0.052	3.121E-1	621	0.125	0.140	O94842.pdb.gz	TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4 PE=1 SV=1
13	AFDB:F4HTH8	0.080	0.057	3.903E-1	1181	0.118	0.069	F4HTH8.pdb.gz	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
14	PDB:7mq8LW	0.064	0.087	5.472E-1	453	0.029	0.044	7mq8LW.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7r5j40	0.060	0.095	5.472E-1	383	0.032	0.057	7r5j40.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:7tdzD	0.066	0.101	5.786E-1	375	0.034	0.064	7tdzD.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
17	PDB:7fikj	0.062	0.047	6.841E-1	1028	0.030	0.020	7fikj.pdb.gz
18	PDB:7mq8LT	0.063	0.054	9.044E-1	869	0.020	0.016	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7mq8LO	0.054	0.047	1.131	848	0.023	0.019	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5hxbY	0.050	0.040	1.414	1080	0.024	0.016	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WXH2	0.0	551	748	0.412	0.384	JPH3_HUMAN Junctophilin-3 OS=Homo sapiens OX=9606 GN=JPH3 PE=1 SV=2
2	Q9BR39	0.0	1400	696	1.000	1.000	JPH2_HUMAN Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2
3	Q9ET77	0.0	553	744	0.412	0.386	JPH3_MOUSE Junctophilin-3 OS=Mus musculus OX=10090 GN=Jph3 PE=1 SV=1
4	Q9ET78	0.0	1052	696	0.864	0.864	JPH2_MOUSE Junctophilin-2 OS=Mus musculus OX=10090 GN=Jph2 PE=1 SV=2
5	Q9ET80	0.0	606	660	0.509	0.536	JPH1_MOUSE Junctophilin-1 OS=Mus musculus OX=10090 GN=Jph1 PE=1 SV=1
6	Q9HDC5	0.0	608	661	0.504	0.531	JPH1_HUMAN Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2
7	Q22667	6.28e-140	429	747	0.319	0.297	Q22667_CAEEL Junctophilin-1 OS=Caenorhabditis elegans OX=6239 GN=jph-1 PE=1 SV=2
8	Q96JJ6	1.32e-128	396	628	0.425	0.471	JPH4_HUMAN Junctophilin-4 OS=Homo sapiens OX=9606 GN=JPH4 PE=1 SV=2
9	Q80WT0	3.22e-124	385	628	0.322	0.357	JPH4_MOUSE Junctophilin-4 OS=Mus musculus OX=10090 GN=Jph4 PE=2 SV=1
10	Q587D3	2.88e-20	95.1	358	0.144	0.279	Q587D3_TRYB2 MORN repeat-containing protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.330 PE=1 SV=1
11	E9PYQ0	1.87e-14	79.7	876	0.072	0.057	RS10B_MOUSE Radial spoke head 10 homolog B OS=Mus musculus OX=10090 GN=Rsph10b PE=1 SV=1
12	Q9M1K2	2.90e-13	75.9	779	0.075	0.067	PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 4 OS=Arabidopsis thaliana OX=3702 GN=PIP5K4 PE=4 SV=1
13	Q9SFB8	6.77e-13	74.3	715	0.070	0.069	PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Arabidopsis thaliana OX=3702 GN=PIP5K6 PE=2 SV=1
14	Q9SLG9	1.85e-12	73.2	772	0.072	0.065	PI5K5_ARATH Phosphatidylinositol 4-phosphate 5-kinase 5 OS=Arabidopsis thaliana OX=3702 GN=PIP5K5 PE=2 SV=1
15	Q57WF5	3.63e-12	71.2	437	0.079	0.126	Q57WF5_TRYB2 MORN repeat-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.670 PE=4 SV=1
16	Q8L850	5.28e-12	71.6	815	0.075	0.064	PI5K9_ARATH Phosphatidylinositol 4-phosphate 5-kinase 9 OS=Arabidopsis thaliana OX=3702 GN=PIP5K9 PE=1 SV=2
17	Q920R0	4.29e-11	68.9	1651	0.066	0.028	ALS2_MOUSE Alsin OS=Mus musculus OX=10090 GN=Als2 PE=1 SV=3
18	Q96Q42	5.09e-11	68.9	1657	0.066	0.028	ALS2_HUMAN Alsin OS=Homo sapiens OX=9606 GN=ALS2 PE=1 SV=2
19	P0C5Y8	1.17e-10	67.8	1651	0.066	0.028	ALS2_RAT Alsin OS=Rattus norvegicus OX=10116 GN=Als2 PE=1 SV=1
20	Q389U2	1.18e-10	67.0	606	0.072	0.083	Q389U2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0580 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02493 MORN	1.4e-31	117.6	MORN repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368966	0.948	Short transient receptor potential channel 3
2	9606.ENSP00000439281	0.927	Triadin
3	9606.ENSP00000341940	0.922	Caveolin-3
4	9606.ENSP00000355533	0.905	Ryanodine receptor 2
5	9606.ENSP00000266376	0.837	Voltage-dependent L-type calcium channel subunit alpha-1C
6	9606.ENSP00000352608	0.832	Ryanodine receptor 1
7	9606.ENSP00000261448	0.776	Calsequestrin-2
8	9606.ENSP00000267113	0.731	Extended synaptotagmin-1
9	9606.ENSP00000312624	0.730	Telethonin
10	9606.ENSP00000355192	0.682	Voltage-dependent L-type calcium channel subunit alpha-1S
11	9606.ENSP00000306997	0.667	Myozenin-2
12	9606.ENSP00000316779	0.662	Myc box-dependent-interacting protein 1
13	9606.ENSP00000267889	0.635	Dispatched RND transporter family member 2
14	9606.ENSP00000358888	0.635	Synaptophysin-like protein 2
15	9606.ENSP00000442795	0.625	Myosin-binding protein C, cardiac-type
16	9606.ENSP00000467141	0.610	Titin
17	9606.ENSP00000269881	0.608	Calreticulin-3
18	9606.ENSP00000386041	0.607	Myosin-6
19	9606.ENSP00000350132	0.590	Cardiac phospholamban
20	9606.ENSP00000431813	0.589	Cysteine and glycine-rich protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043167	0.671	ion binding
GO:0035091	0.475	phosphatidylinositol binding
GO:1901981	0.461	phosphatidylinositol phosphate binding
GO:0043168	0.458	anion binding
GO:0070273	0.402	phosphatidylinositol-4-phosphate binding
GO:0005546	0.385	phosphatidylinositol-4,5-bisphosphate binding
GO:0072341	0.377	modified amino acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0051179	0.987	localization
GO:0034762	0.986	regulation of transmembrane transport
GO:0010959	0.986	regulation of metal ion transport
GO:0034220	0.984	monoatomic ion transmembrane transport
GO:0065009	0.983	regulation of molecular function
GO:0098660	0.982	inorganic ion transmembrane transport
GO:0030001	0.969	metal ion transport
GO:0032412	0.969	regulation of monoatomic ion transmembrane transporter activity
GO:1903169	0.966	regulation of calcium ion transmembrane transport
GO:0007204	0.965	positive regulation of cytosolic calcium ion concentration
GO:0098662	0.965	inorganic cation transmembrane transport
GO:0098655	0.965	monoatomic cation transmembrane transport
GO:0071702	0.954	organic substance transport
GO:0006816	0.941	calcium ion transport
GO:0051282	0.935	regulation of sequestering of calcium ion
GO:0070588	0.918	calcium ion transmembrane transport
GO:1901019	0.910	regulation of calcium ion transmembrane transporter activity
GO:2001257	0.909	regulation of cation channel activity
GO:0051279	0.895	regulation of release of sequestered calcium ion into cytosol
GO:0097553	0.862	calcium ion transmembrane import into cytosol
GO:0048518	0.825	positive regulation of biological process
GO:0043270	0.766	positive regulation of monoatomic ion transport
GO:0048522	0.764	positive regulation of cellular process
GO:1904064	0.741	positive regulation of cation transmembrane transport
GO:0048519	0.548	negative regulation of biological process
GO:0044093	0.529	positive regulation of molecular function
GO:0048523	0.522	negative regulation of cellular process
GO:0032411	0.495	positive regulation of transporter activity
GO:0032501	0.483	multicellular organismal process
GO:0051928	0.468	positive regulation of calcium ion transport
GO:0032414	0.432	positive regulation of ion transmembrane transporter activity
GO:0019222	0.426	regulation of metabolic process
GO:0060255	0.378	regulation of macromolecule metabolic process
GO:0003008	0.306	system process
GO:0048856	0.302	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016529	0.996	sarcoplasmic reticulum
GO:0031090	0.995	organelle membrane
GO:0098588	0.991	bounding membrane of organelle
GO:0005789	0.991	endoplasmic reticulum membrane
GO:0005634	0.984	nucleus
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0033017	0.973	sarcoplasmic reticulum membrane
GO:0032991	0.950	protein-containing complex
GO:0030016	0.943	myofibril
GO:0030017	0.932	sarcomere
GO:0071944	0.691	cell periphery
GO:0005886	0.646	plasma membrane
GO:0070013	0.505	intracellular organelle lumen
GO:0014701	0.368	junctional sarcoplasmic reticulum membrane
GO:0005829	0.339	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]