StarFunc result for job id Q9BR76

User Input

>input (489 residues)
MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAF
LVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSP
LTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFS
RMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITEE
PPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVMTVPRKSDLFQ
DDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA
PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQ
LGRMENGDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BR76	1.000	1.000	2.372E-100	489	1.000	1.000	Q9BR76.pdb.gz	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
2	AFDB:Q9ULV4	0.801	0.826	5.245E-81	474	0.716	0.738	Q9ULV4.pdb.gz	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
3	AFDB:B0R0D7	0.804	0.830	1.011E-79	474	0.712	0.734	B0R0D7.pdb.gz	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
4	AFDB:Q6QEF8	0.804	0.833	4.194E-78	472	0.675	0.699	Q6QEF8.pdb.gz	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
5	AFDB:Q7SX58	0.823	0.884	1.557E-75	455	0.593	0.637	Q7SX58.pdb.gz	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
6	PDB:7styA	0.793	0.994	2.665E-75	390	0.658	0.826	7styA.pdb.gz
7	AFDB:G8G223	0.802	0.850	9.469E-73	461	0.638	0.677	G8G223.pdb.gz	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
8	AFDB:A0A0B4KEJ7	0.796	0.728	1.306E-67	535	0.544	0.497	A0A0B4KEJ7.pdb.gz	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
9	AFDB:Q92828	0.782	0.729	2.486E-58	525	0.442	0.411	Q92828.pdb.gz	COR2A_HUMAN Coronin-2A OS=Homo sapiens OX=9606 GN=CORO2A PE=1 SV=2
10	AFDB:P27133	0.803	0.882	7.042E-58	445	0.382	0.420	P27133.pdb.gz	COROA_DICDI Coronin-A OS=Dictyostelium discoideum OX=44689 GN=corA PE=1 SV=2
11	AFDB:Q8C0P5	0.781	0.729	1.153E-57	524	0.434	0.405	Q8C0P5.pdb.gz	COR2A_MOUSE Coronin-2A OS=Mus musculus OX=10090 GN=Coro2a PE=2 SV=1
12	PDB:2h9lA	0.471	0.690	3.578E-15	321	0.117	0.178	2h9lA.pdb.gz
13	PDB:5nnzA	0.465	0.651	3.992E-15	335	0.119	0.173	5nnzA.pdb.gz
14	PDB:7uwfA	0.458	0.607	9.591E-15	361	0.090	0.122	7uwfA.pdb.gz
15	PDB:5mzhB	0.476	0.550	1.194E-14	415	0.110	0.130	5mzhB.pdb.gz
16	PDB:7zgrD	0.491	0.595	1.659E-14	395	0.112	0.139	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
17	PDB:3jcmB	0.507	0.572	1.851E-14	429	0.115	0.131	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
18	PDB:3w15A	0.471	0.661	2.182E-14	336	0.106	0.155	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
19	PDB:5yzgs	0.426	0.545	3.773E-14	374	0.098	0.128	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:7qe7R	0.500	0.551	4.963E-14	440	0.119	0.132	7qe7R.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KEJ7	0.0	537	535	0.550	0.503	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
2	A0A0B4KEU5	0.0	536	534	0.550	0.504	A0A0B4KEU5_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
3	B0R0D7	0.0	771	474	0.712	0.734	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
4	G8G223	0.0	657	461	0.644	0.683	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
5	O89046	0.0	935	484	0.926	0.936	COR1B_RAT Coronin-1B OS=Rattus norvegicus OX=10116 GN=Coro1b PE=1 SV=1
6	O89053	0.0	664	461	0.638	0.677	COR1A_MOUSE Coronin-1A OS=Mus musculus OX=10090 GN=Coro1a PE=1 SV=5
7	P31146	0.0	666	461	0.644	0.683	COR1A_HUMAN Coronin-1A OS=Homo sapiens OX=9606 GN=CORO1A PE=1 SV=4
8	Q6QEF8	0.0	711	472	0.673	0.697	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
9	Q7JVY0	0.0	543	528	0.550	0.509	Q7JVY0_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
10	Q7SX58	0.0	651	455	0.595	0.640	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
11	Q9BR76	0.0	1014	489	1.000	1.000	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
12	Q9ULV4	0.0	777	474	0.716	0.738	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
13	Q9WUM3	0.0	953	484	0.941	0.950	COR1B_MOUSE Coronin-1B OS=Mus musculus OX=10090 GN=Coro1b PE=1 SV=1
14	Q9WUM4	0.0	778	474	0.722	0.745	COR1C_MOUSE Coronin-1C OS=Mus musculus OX=10090 GN=Coro1c PE=1 SV=2
15	Q92828	1.55e-145	429	525	0.440	0.410	COR2A_HUMAN Coronin-2A OS=Homo sapiens OX=9606 GN=CORO2A PE=1 SV=2
16	Q9UQ03	2.09e-140	414	480	0.409	0.417	COR2B_HUMAN Coronin-2B OS=Homo sapiens OX=9606 GN=CORO2B PE=1 SV=4
17	Q8BH44	2.20e-140	414	480	0.407	0.415	COR2B_MOUSE Coronin-2B OS=Mus musculus OX=10090 GN=Coro2b PE=1 SV=2
18	Q8C0P5	2.29e-139	413	524	0.395	0.368	COR2A_MOUSE Coronin-2A OS=Mus musculus OX=10090 GN=Coro2a PE=2 SV=1
19	P27133	1.19e-128	383	445	0.366	0.402	COROA_DICDI Coronin-A OS=Dictyostelium discoideum OX=44689 GN=corA PE=1 SV=2
20	O13923	1.15e-106	332	601	0.339	0.276	CORO_SCHPO Coronin-like protein crn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.0013	30.3	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08953 DUF1899	1.6e-29	112.9	Domain of unknown function (DUF1899)
3	PF20426 NBCH_WD40	25	15.2	Neurobeachin beta propeller domain
4	PF08954 Trimer_CC	0.02	25.8	Trimerisation motif
5	PF00400 WD40	1.2e-10	53.0	WD domain, G-beta repeat
6	PF16300 WD40_4	3.2e-19	79.8	Type of WD40 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377471

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432660	0.885	Cofilin-1
2	9606.ENSP00000295685	0.879	Actin-related protein 2/3 complex subunit 2
3	9606.ENSP00000219150	0.856	Coronin-1A
4	9606.ENSP00000394496	0.779	Coronin-1C
5	9606.ENSP00000367220	0.767	Actin-related protein 2
6	9606.ENSP00000328169	0.737	Protein jagged-2
7	9606.ENSP00000396620	0.707	Nuclear transcription factor Y subunit gamma
8	9606.ENSP00000458162	0.696	Actin, cytoplasmic 2
9	9606.ENSP00000344562	0.686	Coronin-6
10	9606.ENSP00000484472	0.662	Epiplakin
11	9606.ENSP00000315713	0.639	Protein phosphatase Slingshot homolog 1
12	9606.ENSP00000357564	0.637	Ras-related protein Rab-13
13	9606.ENSP00000365745	0.637	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
14	9606.ENSP00000263238	0.600	Actin-related protein 3
15	9606.ENSP00000428489	0.593	Lymphokine-activated killer T-cell-originated protein kinase
16	9606.ENSP00000365884	0.589	Tripartite motif containing 15
17	9606.ENSP00000427687	0.567	WD repeat-containing protein 1
18	9606.ENSP00000223023	0.563	Neural Wiskott-Aldrich syndrome protein
19	9606.ENSP00000349960	0.556	Actin, cytoplasmic 1
20	9606.ENSP00000365891	0.544	Wiskott-Aldrich syndrome protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.999	protein-containing complex binding
GO:0008092	0.994	cytoskeletal protein binding
GO:0051015	0.978	actin filament binding
GO:0042802	0.723	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0040012	0.984	regulation of locomotion
GO:1902743	0.983	regulation of lamellipodium organization
GO:0016043	0.978	cellular component organization
GO:0110053	0.975	regulation of actin filament organization
GO:0051125	0.968	regulation of actin nucleation
GO:0040013	0.959	negative regulation of locomotion
GO:2000145	0.954	regulation of cell motility
GO:0070848	0.953	response to growth factor
GO:0030334	0.944	regulation of cell migration
GO:2000146	0.931	negative regulation of cell motility
GO:0071363	0.930	cellular response to growth factor stimulus
GO:0051129	0.882	negative regulation of cellular component organization
GO:0006996	0.873	organelle organization
GO:0036119	0.868	response to platelet-derived growth factor
GO:0036120	0.861	cellular response to platelet-derived growth factor stimulus
GO:0032501	0.850	multicellular organismal process
GO:0014910	0.841	regulation of smooth muscle cell migration
GO:0030029	0.837	actin filament-based process
GO:0007010	0.815	cytoskeleton organization
GO:0048518	0.766	positive regulation of biological process
GO:0007015	0.765	actin filament organization
GO:0032102	0.764	negative regulation of response to external stimulus
GO:0051179	0.746	localization
GO:0030335	0.732	positive regulation of cell migration
GO:0030336	0.718	negative regulation of cell migration
GO:0050922	0.705	negative regulation of chemotaxis
GO:0051716	0.703	cellular response to stimulus
GO:0022604	0.666	regulation of cell morphogenesis
GO:0051130	0.650	positive regulation of cellular component organization
GO:0010639	0.584	negative regulation of organelle organization
GO:1902904	0.580	negative regulation of supramolecular fiber organization
GO:0031346	0.491	positive regulation of cell projection organization
GO:1902745	0.467	positive regulation of lamellipodium organization
GO:0048870	0.463	cell motility
GO:0019222	0.442	regulation of metabolic process
GO:0042221	0.405	response to chemical
GO:0070887	0.403	cellular response to chemical stimulus
GO:0016477	0.384	cell migration
GO:0009605	0.358	response to external stimulus
GO:0060255	0.351	regulation of macromolecule metabolic process
GO:0032502	0.328	developmental process
GO:0006935	0.328	chemotaxis
GO:0044085	0.317	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015629	0.999	actin cytoskeleton
GO:0043227	0.998	membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0016020	0.996	membrane
GO:0071944	0.994	cell periphery
GO:0031982	0.993	vesicle
GO:0120025	0.990	plasma membrane bounded cell projection
GO:0005576	0.980	extracellular region
GO:0031252	0.976	cell leading edge
GO:0030027	0.972	lamellipodium
GO:0099512	0.966	supramolecular fiber
GO:0005886	0.959	plasma membrane
GO:0070062	0.956	extracellular exosome
GO:0032991	0.944	protein-containing complex
GO:0070161	0.942	anchoring junction
GO:0043231	0.906	intracellular membrane-bounded organelle
GO:0042641	0.846	actomyosin
GO:0097517	0.839	contractile actin filament bundle
GO:0001725	0.832	stress fiber
GO:0099513	0.821	polymeric cytoskeletal fiber
GO:0030055	0.799	cell-substrate junction
GO:0005884	0.732	actin filament
GO:0048471	0.708	perinuclear region of cytoplasm
GO:0005925	0.707	focal adhesion
GO:0097708	0.480	intracellular vesicle
GO:0031410	0.474	cytoplasmic vesicle
GO:0005938	0.389	cell cortex
GO:0001726	0.375	ruffle
GO:0012505	0.339	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]