StarFunc result for job id Q9BRA0

User Input

>input (125 residues)
MAGAGPTMLLREENGCCSRRQSSSSAGDSDGEREDSAAERARQQLEALLNKTMRIRMTDG
RTLVGCFLCTDRDCNVILGSAQEFLKPSDSFSAGEPRVLGLAMVPGHHIVSIEVQRESLT
GPPYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I3L3Z2	0.669	0.622	9.951E-18	135	1.000	0.926	I3L3Z2.pdb.gz	I3L3Z2_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA38 PE=1 SV=2
2	AFDB:A0A0B4J297	0.503	0.828	4.319E-10	73	0.576	0.986	A0A0B4J297.pdb.gz	A0A0B4J297_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA38 PE=1 SV=1
3	AFDB:O43080	0.612	0.657	3.809E-8	116	0.232	0.250	O43080.pdb.gz	NAA38_SCHPO N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naa38 PE=1 SV=2
4	AFDB:A0A384KDW9	0.538	0.595	2.639E-7	112	0.240	0.268	A0A384KDW9.pdb.gz	A0A384KDW9_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At4g18372 PE=1 SV=1
5	PDB:3jb9E	0.470	0.589	2.778E-7	98	0.224	0.286	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
6	AFDB:Q10163	0.477	0.411	8.908E-7	147	0.248	0.211	Q10163.pdb.gz	RSMB_SCHPO Small nuclear ribonucleoprotein-associated protein B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smb1 PE=1 SV=1
7	AFDB:Q586Q6	0.515	0.584	1.241E-6	109	0.200	0.229	Q586Q6.pdb.gz	Q586Q6_TRYB2 Small nuclear ribonucleoprotein SmD1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.310 PE=4 SV=1
8	AFDB:Q05856	0.491	0.318	1.386E-6	199	0.224	0.141	Q05856.pdb.gz	RSMB_DROME Small nuclear ribonucleoprotein-associated protein B OS=Drosophila melanogaster OX=7227 GN=SmB PE=1 SV=1
9	AFDB:Q9FI15	0.487	0.251	1.465E-6	254	0.232	0.114	Q9FI15.pdb.gz	Q9FI15_ARATH Small nuclear ribonucleoprotein-associated protein OS=Arabidopsis thaliana OX=3702 GN=MFC16.18 PE=2 SV=1
10	PDB:7w59b	0.481	0.580	1.924E-6	102	0.216	0.265	7w59b.pdb.gz	Mechanism of exon ligation by human spliceosome.
11	AFDB:P14678	0.497	0.273	3.178E-6	240	0.240	0.125	P14678.pdb.gz	RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B' OS=Homo sapiens OX=9606 GN=SNRPB PE=1 SV=2
12	AFDB:Q9SUN5	0.461	0.234	3.178E-6	257	0.224	0.109	Q9SUN5.pdb.gz	Q9SUN5_ARATH Small nuclear ribonucleoprotein-associated protein OS=Arabidopsis thaliana OX=3702 GN=SMB PE=1 SV=1
13	PDB:7l1kC	0.495	0.857	5.207E-6	70	0.224	0.400	7l1kC.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
14	PDB:3pgwQ	0.460	0.721	5.816E-6	76	0.184	0.303	3pgwQ.pdb.gz
15	PDB:6ppqG	0.499	0.713	6.147E-6	85	0.184	0.271	6ppqG.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
16	PDB:3jcr7	0.502	0.758	1.069E-5	79	0.168	0.266	3jcr7.pdb.gz
17	PDB:4c92G	0.485	0.778	1.194E-5	75	0.144	0.240	4c92G.pdb.gz
18	PDB:6bk8f	0.491	0.739	2.318E-5	80	0.184	0.287	6bk8f.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
19	PDB:6v4xG	0.500	0.784	2.318E-5	77	0.112	0.182	6v4xG.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
20	PDB:5o9zp	0.465	0.746	2.736E-5	73	0.120	0.205	5o9zp.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRA0	4.20e-89	255	125	1.000	1.000	LSMD1_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA38 PE=1 SV=1
2	I3L3Z2	3.66e-85	246	135	1.000	0.926	I3L3Z2_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA38 PE=1 SV=2
3	I3L4V0	1.16e-68	203	99	0.784	0.990	I3L4V0_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA38 PE=1 SV=1
4	A0A0B4J297	1.20e-49	154	73	0.584	1.000	A0A0B4J297_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA38 PE=1 SV=1
5	I3L310	4.49e-46	145	83	0.584	0.880	I3L310_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA38 PE=1 SV=1
6	O43080	1.09e-09	54.3	116	0.272	0.293	NAA38_SCHPO N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naa38 PE=1 SV=2
7	Q9SUN5	6.33e-08	51.2	257	0.240	0.117	Q9SUN5_ARATH Small nuclear ribonucleoprotein-associated protein OS=Arabidopsis thaliana OX=3702 GN=SMB PE=1 SV=1
8	Q9FI15	2.98e-07	49.7	254	0.232	0.114	Q9FI15_ARATH Small nuclear ribonucleoprotein-associated protein OS=Arabidopsis thaliana OX=3702 GN=MFC16.18 PE=2 SV=1
9	Q10163	4.28e-07	48.1	147	0.256	0.218	RSMB_SCHPO Small nuclear ribonucleoprotein-associated protein B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smb1 PE=1 SV=1
10	Q05856	2.08e-06	46.6	199	0.224	0.141	RSMB_DROME Small nuclear ribonucleoprotein-associated protein B OS=Drosophila melanogaster OX=7227 GN=SmB PE=1 SV=1
11	P17136	3.07e-06	46.6	231	0.240	0.130	RSMB_RAT Small nuclear ribonucleoprotein-associated protein B OS=Rattus norvegicus OX=10116 GN=Snrpb PE=2 SV=2
12	P27048	3.07e-06	46.6	231	0.240	0.130	RSMB_MOUSE Small nuclear ribonucleoprotein-associated protein B OS=Mus musculus OX=10090 GN=Snrpb PE=1 SV=1
13	Q66K91	3.07e-06	46.6	231	0.240	0.130	Q66K91_HUMAN Small nuclear ribonucleoprotein-associated protein OS=Homo sapiens OX=9606 GN=SNRPB PE=1 SV=1
14	P14678	3.29e-06	46.6	240	0.240	0.125	RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B' OS=Homo sapiens OX=9606 GN=SNRPB PE=1 SV=2
15	Q586Q6	7.90e-06	43.9	109	0.176	0.202	Q586Q6_TRYB2 Small nuclear ribonucleoprotein SmD1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.310 PE=4 SV=1
16	J3QLE5	2.63e-05	43.5	169	0.224	0.166	J3QLE5_HUMAN Small nuclear ribonucleoprotein polypeptide N (Fragment) OS=Homo sapiens OX=9606 GN=SNRPN PE=1 SV=1
17	P63162	5.13e-05	43.1	240	0.224	0.117	RSMN_HUMAN Small nuclear ribonucleoprotein-associated protein N OS=Homo sapiens OX=9606 GN=SNRPN PE=1 SV=1
18	P63163	5.13e-05	43.1	240	0.224	0.117	RSMN_MOUSE Small nuclear ribonucleoprotein-associated protein N OS=Mus musculus OX=10090 GN=Snrpn PE=1 SV=1
19	P63164	5.13e-05	43.1	240	0.224	0.117	RSMN_RAT Small nuclear ribonucleoprotein-associated protein N OS=Rattus norvegicus OX=10116 GN=Snrpn PE=2 SV=1
20	X5DP00	5.13e-05	43.1	240	0.224	0.117	X5DP00_HUMAN HCG15924, isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=SNRPN PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06372 Gemin6	2.1e+02	13.3	Gemin6 Sm-like domain
2	PF01423 LSM	8.6e-10	49.5	LSM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010360701.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354132.1	0.997	RNA-binding protein 25
2	61622.XP_010383686.1	0.989	pre-mRNA processing factor 40 homolog B
3	61622.XP_010375768.1	0.984	Small nuclear ribonucleoprotein Sm D2
4	61622.XP_010353183.1	0.978	Small nuclear ribonucleoprotein Sm D1
5	61622.XP_010355474.1	0.978	Small nuclear ribonucleoprotein F-like
6	61622.XP_010358733.1	0.978	LSM10, U7 small nuclear RNA associated
7	61622.XP_010360199.1	0.978	Small nuclear ribonucleoprotein G isoform X1
8	61622.XP_010382200.1	0.978	Small nuclear ribonucleoprotein F
9	61622.XP_010366557.1	0.977	CWC27 spliceosome associated protein homolog
10	61622.XP_010383262.1	0.977	pre-mRNA-processing factor 19
11	61622.XP_010360830.1	0.974	Splicing factor 3B subunit 5
12	61622.XP_010384941.1	0.970	LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
13	61622.XP_010381643.1	0.969	LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
14	61622.XP_010382781.1	0.969	LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
15	61622.XP_010352299.1	0.968	Elongation factor Tu GTP binding domain containing 2
16	61622.XP_010374612.1	0.967	Small nuclear ribonucleoprotein Sm D3
17	61622.XP_010387936.1	0.967	Small nuclear ribonucleoprotein D3 polypeptide
18	61622.XP_010364735.1	0.964	Splicing factor 3b subunit 2
19	61622.XP_010360379.1	0.963	U5 small nuclear ribonucleoprotein 200 kDa helicase
20	61622.XP_010371814.1	0.963	pre-mRNA processing factor 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.827	nucleic acid binding
GO:0003723	0.684	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.979	regulation of cellular process
GO:0048519	0.950	negative regulation of biological process
GO:0043066	0.873	negative regulation of apoptotic process
GO:0071704	0.870	organic substance metabolic process
GO:0044238	0.858	primary metabolic process
GO:0044237	0.858	cellular metabolic process
GO:0006807	0.846	nitrogen compound metabolic process
GO:0043170	0.838	macromolecule metabolic process
GO:0010467	0.825	gene expression
GO:0006139	0.825	nucleobase-containing compound metabolic process
GO:0006396	0.822	RNA processing
GO:0016071	0.820	mRNA metabolic process
GO:0008380	0.801	RNA splicing
GO:0006397	0.783	mRNA processing
GO:0000398	0.679	mRNA splicing, via spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.965	cytoplasm
GO:0032991	0.946	protein-containing complex
GO:1990904	0.770	ribonucleoprotein complex
GO:0012505	0.504	endomembrane system
GO:1902494	0.344	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]