StarFunc result for job id Q9BRA2

User Input

>input (123 residues)
MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHI
SEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF
SED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRA2	1.000	1.000	5.100E-28	123	1.000	1.000	Q9BRA2.pdb.gz	TXD17_HUMAN Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1
2	PDB:1wouA	0.950	0.982	2.352E-24	119	0.967	1.000	1wouA.pdb.gz
3	AFDB:T1SH39	0.979	0.979	4.516E-21	123	0.659	0.659	T1SH39.pdb.gz	TXD17_EPICO Thioredoxin domain-containing protein 17 OS=Epinephelus coioides OX=94232 PE=2 SV=1
4	AFDB:Q9VMQ9	0.911	0.890	6.282E-14	126	0.382	0.373	Q9VMQ9.pdb.gz	Q9VMQ9_DROME Thioredoxin domain-containing protein 17 OS=Drosophila melanogaster OX=7227 GN=cl PE=1 SV=1
5	AFDB:Q9FMN4	0.881	0.813	8.241E-10	134	0.285	0.261	Q9FMN4.pdb.gz	TCLOT_ARATH Thioredoxin-like protein Clot OS=Arabidopsis thaliana OX=3702 GN=At5g42850 PE=2 SV=1
6	AFDB:Q9P7L1	0.703	0.699	4.496E-8	124	0.285	0.282	Q9P7L1.pdb.gz	YOSC_SCHPO Thioredoxin domain-containing protein C21C3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21C3.12c PE=3 SV=1
7	PDB:6zmuA	0.564	0.627	7.880E-5	107	0.187	0.215	6zmuA.pdb.gz
8	AFDB:Q8IFW4	0.583	0.475	1.847E-4	157	0.171	0.134	Q8IFW4.pdb.gz	THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster OX=7227 GN=TrxT PE=1 SV=1
9	AFDB:Q8LDI5	0.508	0.525	1.847E-4	118	0.228	0.237	Q8LDI5.pdb.gz	CXXS1_ARATH Thioredoxin-like protein CXXS1 OS=Arabidopsis thaliana OX=3702 GN=CXXS1 PE=2 SV=2
10	AFDB:O22229	0.531	0.153	1.970E-4	529	0.098	0.023	O22229.pdb.gz	TRXB3_ARATH NADPH-dependent thioredoxin reductase 3 OS=Arabidopsis thaliana OX=3702 GN=NTRC PE=1 SV=2
11	PDB:1xwaA	0.568	0.617	2.212E-4	111	0.154	0.171	1xwaA.pdb.gz
12	AFDB:P47938	0.575	0.639	2.550E-4	107	0.187	0.215	P47938.pdb.gz	THIO1_DROME Thioredoxin-1 OS=Drosophila melanogaster OX=7227 GN=dhd PE=1 SV=1
13	PDB:6z7oA	0.573	0.626	3.474E-4	110	0.187	0.209	6z7oA.pdb.gz	Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins.
14	AFDB:Q42403	0.583	0.603	3.521E-4	118	0.236	0.246	Q42403.pdb.gz	TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana OX=3702 GN=TRX3 PE=1 SV=1
15	PDB:2l4qA	0.564	0.591	2.114E-3	116	0.211	0.224	2l4qA.pdb.gz
16	PDB:6iblA	0.559	0.207	2.114E-3	397	0.130	0.040	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
17	PDB:4pufC	0.530	0.570	2.405E-3	112	0.179	0.196	4pufC.pdb.gz
18	PDB:4j56E	0.557	0.631	2.919E-3	105	0.187	0.219	4j56E.pdb.gz	Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
19	PDB:3f3qA	0.580	0.639	3.778E-3	109	0.179	0.202	3f3qA.pdb.gz	Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
20	PDB:3qouA	0.509	0.262	4.890E-3	282	0.146	0.064	3qouA.pdb.gz	Escherichia coli Thioredoxin-like Protein YbbN Contains an Atypical Tetratricopeptide Repeat Motif and Is a Negative Regulator of GroEL.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRA2	1.11e-90	259	123	1.000	1.000	TXD17_HUMAN Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1
2	T1SH39	2.71e-60	182	123	0.659	0.659	TXD17_EPICO Thioredoxin domain-containing protein 17 OS=Epinephelus coioides OX=94232 PE=2 SV=1
3	Q9VMQ9	2.81e-27	99.4	126	0.407	0.397	Q9VMQ9_DROME Thioredoxin domain-containing protein 17 OS=Drosophila melanogaster OX=7227 GN=cl PE=1 SV=1
4	Q9FMN4	6.57e-14	65.5	134	0.268	0.246	TCLOT_ARATH Thioredoxin-like protein Clot OS=Arabidopsis thaliana OX=3702 GN=At5g42850 PE=2 SV=1
5	Q9P7L1	3.22e-10	55.5	124	0.268	0.266	YOSC_SCHPO Thioredoxin domain-containing protein C21C3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21C3.12c PE=3 SV=1
6	Q9HAY6	0.15	33.5	547	0.106	0.024	BCDO1_HUMAN Beta,beta-carotene 15,15'-dioxygenase OS=Homo sapiens OX=9606 GN=BCO1 PE=1 SV=1
7	Q9ZR86	0.61	31.6	569	0.220	0.047	Q9ZR86_MAIZE PDI-like protein OS=Zea mays OX=4577 PE=2 SV=1
8	Q9SGS4	0.86	31.2	302	0.211	0.086	CDSP_ARATH Thioredoxin-like protein CDSP32, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CDSP32 PE=1 SV=1
9	P25372	1.3	30.0	127	0.179	0.173	TRX3_YEAST Thioredoxin-3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRX3 PE=1 SV=1
10	Q57WB2	1.3	30.0	144	0.114	0.097	Q57WB2_TRYB2 Tryparedoxin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.740 PE=4 SV=1
11	Q57WB4	1.4	30.0	144	0.114	0.097	Q57WB4_TRYB2 Tryparedoxin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.710 PE=4 SV=1
12	O80763	1.7	30.4	578	0.236	0.050	NRX1_ARATH Probable nucleoredoxin 1 OS=Arabidopsis thaliana OX=3702 GN=At1g60420 PE=1 SV=1
13	Q9JJS6	1.7	30.4	566	0.106	0.023	BCDO1_MOUSE Beta,beta-carotene 15,15'-dioxygenase OS=Mus musculus OX=10090 GN=Bco1 PE=1 SV=2
14	Q91XT5	1.8	30.0	566	0.106	0.023	BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus OX=10116 GN=Bco1 PE=2 SV=1
15	Q39239	4.8	28.1	119	0.203	0.210	TRXH4_ARATH Thioredoxin H4 OS=Arabidopsis thaliana OX=3702 GN=TRX4 PE=1 SV=2
16	Q9ZQN8	6.0	28.9	556	0.114	0.025	CSLA7_ARATH Glucomannan 4-beta-mannosyltransferase 7 OS=Arabidopsis thaliana OX=3702 GN=CSLA7 PE=1 SV=2
17	Q94282	6.4	28.1	158	0.114	0.089	Q94282_CAEEL Thioredoxin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=trx-3 PE=4 SV=2
18	C0H561	6.6	28.1	128	0.130	0.125	C0H561_PLAF7 Thioredoxin-like protein 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0925500 PE=4 SV=1
19	P55135	6.7	28.5	433	0.089	0.025	RLMD_ECOLI 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Escherichia coli (strain K12) OX=83333 GN=rlmD PE=1 SV=3
20	A0MD28	7.2	28.5	3838	0.098	0.003	RPOA_PRRSS Replicase polyprotein 1ab OS=Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) OX=857306 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06110 DUF953	1.3e-42	155.5	Eukaryotic protein of unknown function (DUF953)
2	PF00462 Glutaredoxin	5.8e+02	12.1	Glutaredoxin
3	PF00085 Thioredoxin	9.6	17.6	Thioredoxin
4	PF14595 Thioredoxin_9	5e+02	11.9	Thioredoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011250

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000006074	0.722	COX17 cytochrome c oxidase copper chaperone
2	61853.ENSNLEP00000001293	0.684	annotation not available
3	61853.ENSNLEP00000007997	0.684	Thioredoxin reductase 1
4	61853.ENSNLEP00000009780	0.681	Thioredoxin-like 1
5	61853.ENSNLEP00000019011	0.654	Dynein, light chain, LC8-type 1
6	61853.ENSNLEP00000010320	0.582	Transient receptor potential cation channel, subfamily C, member 7
7	61853.ENSNLEP00000002559	0.555	NADH:ubiquinone oxidoreductase subunit B2
8	61853.ENSNLEP00000016769	0.553	CD244 molecule, natural killer cell receptor 2B4
9	61853.ENSNLEP00000013432	0.547	N-ribosyldihydronicotinamide:quinone reductase 2
10	61853.ENSNLEP00000015339	0.531	Caseinolytic mitochondrial matrix peptidase chaperone subunit
11	61853.ENSNLEP00000006782	0.526	Thioredoxin reductase 2
12	61853.ENSNLEP00000005200	0.520	Regulator of calcineurin 1
13	61853.ENSNLEP00000008798	0.503	CWF19-like 2, cell cycle control (S. pombe)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004601	1.000	peroxidase activity
GO:0047134	1.000	protein-disulfide reductase (NAD(P)) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0070887	0.977	cellular response to chemical stimulus
GO:0065007	0.967	biological regulation
GO:0050794	0.961	regulation of cellular process
GO:0034612	0.905	response to tumor necrosis factor
GO:0007165	0.848	signal transduction
GO:0033209	0.782	tumor necrosis factor-mediated signaling pathway
GO:0008152	0.414	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	1.000	cytosol
GO:0070062	0.989	extracellular exosome
GO:0043231	0.936	intracellular membrane-bounded organelle
GO:0070013	0.823	intracellular organelle lumen
GO:0005634	0.787	nucleus
GO:0005654	0.531	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.11.1.-	1.000	Peroxidases.
EC:1.8.1.8	1.000	protein-disulfide reductase.

[back to server]