StarFunc result for job id Q9BRB3

User Input

>input (760 residues)
MVLKAFFPTCCVSTDSGLLVGRWVPEQSSAVVLAVLHFPFIPIQVKQLLAQVRQASQVGV
AVLGTWCHCRQEPEESLGRFLESLGAVFPHEPWLRLCRERGGTFWSCEATHRQAPTAPGA
PGEDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDR
FDEGPVRLSHWQSEGVEASILAELARRASGPICLLLASLLSLVSAVSACRVFKLWPLSFL
GSKLSTCEQLRHRLEHLTLIFSTRKAENPAQLMRKANTVASVLLDVALGLMLLSWLHGRS
RIGHLADALVPVADHVAEELQHLLQWLMGAPAGLKMNRALDQVLGRFFLYHIHLWISYIH
LMSPFVEHILWHVGLSACLGLTVALSLLSDIIALLTFHIYCFYVYGARLYCLKIHGLSSL
WRLFRGKKWNVLRQRVDSCSYDLDQLFIGTLLFTILLFLLPTTALYYLVFTLLRLLVVAV
QGLIHLLVDLINSLPLYSLGLRLCRPYRLADKPTALQPRGAHLPPPQLWLPPQALLGRPV
PQAVPWGAHLPLEAERGQAGLRELLARLAPPHGHSQPSALPGWHQLSWRMSCALWTLLCA
PEHGRPCYHTLGLEVIGSEQMWGWPARLAALHHWHCLPWDPLPTCCGHHGGEHSNPRCPE
HCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGVEGPCQDEPPSPRHPLAPSAE
QHPASGGLKQSLTPVPSGPGPSLPEPHGVYLRMFPGEVAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRB3	1.000	1.000	0.000	760	1.000	1.000	Q9BRB3.pdb.gz	PIGQ_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Homo sapiens OX=9606 GN=PIGQ PE=1 SV=3
2	AFDB:Q9QYT7	0.419	0.540	2.571E-65	581	0.558	0.730	Q9QYT7.pdb.gz	PIGQ_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Mus musculus OX=10090 GN=Pigq PE=1 SV=3
3	AFDB:O14357	0.367	0.424	2.601E-22	653	0.154	0.179	O14357.pdb.gz	GPI1_SCHPO N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi1 PE=2 SV=1
4	AFDB:C6KT29	0.363	0.377	4.905E-13	729	0.107	0.111	C6KT29.pdb.gz	C6KT29_PLAF7 Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0618900.1 PE=4 SV=1
5	AFDB:P49418	0.063	0.066	2.826E-3	695	0.089	0.098	P49418.pdb.gz	AMPH_HUMAN Amphiphysin OS=Homo sapiens OX=9606 GN=AMPH PE=1 SV=1
6	PDB:6zonF	0.135	0.308	3.800E-3	269	0.049	0.138	6zonF.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
7	PDB:4wsnF	0.137	0.307	1.161E-2	288	0.046	0.122	4wsnF.pdb.gz	Cullin-RING ubiquitin E3 ligase regulation by the COP9 signalosome.
8	AFDB:Q9UBW5	0.079	0.099	1.472E-2	565	0.078	0.104	Q9UBW5.pdb.gz	BIN2_HUMAN Bridging integrator 2 OS=Homo sapiens OX=9606 GN=BIN2 PE=1 SV=3
9	AFDB:Q98SV4	0.064	0.062	1.622E-2	816	0.113	0.105	Q98SV4.pdb.gz	Q98SV4_ICTPU Delayed rectifier potassium channel Kv2 OS=Ictalurus punctatus OX=7998 GN=kcnb2b PE=2 SV=1
10	AFDB:Q9Z0Y8	0.077	0.040	1.622E-2	2201	0.134	0.046	Q9Z0Y8.pdb.gz	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
11	PDB:6j30U	0.141	0.351	2.919E-2	262	0.037	0.107	6j30U.pdb.gz	Structural Snapshots of 26S Proteasome Reveal Tetraubiquitin-Induced Conformations.
12	AFDB:A0A0B4KFZ2	0.071	0.055	3.200E-2	1161	0.089	0.059	A0A0B4KFZ2.pdb.gz	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
13	PDB:6fvtU	0.132	0.287	3.217E-2	304	0.050	0.125	6fvtU.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
14	AFDB:Q3UW53	0.093	0.085	3.702E-2	926	0.124	0.102	Q3UW53.pdb.gz	NIBA1_MOUSE Protein Niban 1 OS=Mus musculus OX=10090 GN=Niban1 PE=1 SV=2
15	PDB:5l4kU	0.123	0.272	4.518E-2	292	0.057	0.147	5l4kU.pdb.gz
16	PDB:5ln3U	0.126	0.305	2.242E-1	272	0.038	0.107	5ln3U.pdb.gz	Molecular Details Underlying Dynamic Structures and Regulation of the Human 26S Proteasome.
17	PDB:5gjqV	0.127	0.306	2.722E-1	257	0.038	0.113	5gjqV.pdb.gz	An atomic structure of the human 26S proteasome.
18	PDB:6gvwB	0.146	0.342	2.858E-1	262	0.039	0.115	6gvwB.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
19	PDB:6ysnA	0.092	0.107	9.162E-1	606	0.067	0.084	6ysnA.pdb.gz	Human TRPC5 structures reveal interaction of a xanthine-based TRPC1/4/5 inhibitor with a conserved lipid binding site.
20	PDB:6ww7H	0.083	0.249	1.168	182	0.018	0.077	6ww7H.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRB3	0.0	1516	760	1.000	1.000	PIGQ_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Homo sapiens OX=9606 GN=PIGQ PE=1 SV=3
2	Q9QYT7	0.0	799	581	0.562	0.735	PIGQ_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Mus musculus OX=10090 GN=Pigq PE=1 SV=3
3	O14357	5.27e-34	140	653	0.107	0.124	GPI1_SCHPO N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi1 PE=2 SV=1
4	Q93438	2.04e-31	125	269	0.100	0.283	Q93438_CAEEL PMT_2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pigq-1 PE=4 SV=2
5	P53306	1.37e-25	114	609	0.124	0.154	GPI1_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI1 PE=1 SV=1
6	C6KT29	7.09e-18	90.5	729	0.075	0.078	C6KT29_PLAF7 Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0618900.1 PE=4 SV=1
7	F4K2L8	0.37	36.2	288	0.054	0.142	F4K2L8_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g19750 PE=1 SV=1
8	Q9JKS6	0.75	35.8	5085	0.046	0.007	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1
9	O75601	1.7	34.3	377	0.028	0.056	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
10	P0DTC1	4.9	33.1	4405	0.049	0.008	R1A_SARS2 Replicase polyprotein 1a OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 PE=1 SV=1
11	P0DTD1	5.0	33.1	7096	0.049	0.005	R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05024 Gpi1	1e-81	285.8	N-acetylglucosaminyl transferase component (Gpi1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000026218

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356702	0.998	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
2	9606.ENSP00000216452	0.996	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
3	9606.ENSP00000369820	0.995	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
4	9606.ENSP00000420037	0.993	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
5	9606.ENSP00000225609	0.992	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
6	9606.ENSP00000322181	0.982	Dolichol phosphate-mannose biosynthesis regulatory protein
7	9606.ENSP00000432688	0.954	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y
8	9606.ENSP00000363260	0.875	GPI mannosyltransferase 2
9	9606.ENSP00000357069	0.874	GPI mannosyltransferase 1
10	9606.ENSP00000367880	0.868	GPI ethanolamine phosphate transferase 3
11	9606.ENSP00000273968	0.866	Protein preY, mitochondrial
12	9606.ENSP00000415203	0.857	GPI ethanolamine phosphate transferase 2
13	9606.ENSP00000164305	0.830	GPI mannosyltransferase 3
14	9606.ENSP00000359848	0.828	GPI-anchor transamidase
15	9606.ENSP00000482202	0.819	Phosphatidylinositol-glycan biosynthesis class W protein
16	9606.ENSP00000350263	0.814	GPI ethanolamine phosphate transferase 1
17	9606.ENSP00000219789	0.809	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
18	9606.ENSP00000360644	0.769	Dolichol-phosphate mannosyltransferase subunit 1
19	9606.ENSP00000279036	0.763	GPI transamidase component PIG-T
20	9606.ENSP00000300658	0.739	Post-GPI attachment to proteins factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.708	catalytic activity
GO:0016740	0.657	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044249	0.990	cellular biosynthetic process
GO:1901135	0.989	carbohydrate derivative metabolic process
GO:0019637	0.989	organophosphate metabolic process
GO:1901566	0.986	organonitrogen compound biosynthetic process
GO:0036211	0.986	protein modification process
GO:0044260	0.979	cellular macromolecule metabolic process
GO:1901137	0.978	carbohydrate derivative biosynthetic process
GO:0090407	0.977	organophosphate biosynthetic process
GO:0006796	0.974	phosphate-containing compound metabolic process
GO:0034645	0.972	cellular macromolecule biosynthetic process
GO:0008610	0.970	lipid biosynthetic process
GO:0046486	0.966	glycerolipid metabolic process
GO:0006497	0.961	protein lipidation
GO:0006661	0.960	phosphatidylinositol biosynthetic process
GO:0006506	0.941	GPI anchor biosynthetic process
GO:0005975	0.864	carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane
GO:1990234	0.999	transferase complex
GO:0098796	0.999	membrane protein complex
GO:0140534	0.999	endoplasmic reticulum protein-containing complex
GO:0000506	0.752	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.657	Transferases.

[back to server]