StarFunc result for job id Q9BRC7

User Input

>input (762 residues)
MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQ
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRKILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQNKD
KKKKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETKAKRLIKEAGNEFV
QHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCG
YVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKEGSIVDPLVKVQIF
GVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTL
PWTCMQQGYRHIHLLSKDGISLRPASIFVYICIQEGLEGDES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C9JEA7	0.959	0.921	0.000	794	0.999	0.958	C9JEA7.pdb.gz	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
2	AFDB:Q62711	0.972	0.959	0.000	772	0.736	0.727	Q62711.pdb.gz	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
3	AFDB:Q8K3R3	0.934	0.883	0.000	807	0.747	0.705	Q8K3R3.pdb.gz	PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus OX=10090 GN=Plcd4 PE=1 SV=2
4	AFDB:Q9BRC7	1.000	1.000	0.000	762	1.000	1.000	Q9BRC7.pdb.gz	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
5	AFDB:F1Q5G9	0.927	0.928	1.325E-103	761	0.571	0.572	F1Q5G9.pdb.gz	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
6	AFDB:P10688	0.888	0.895	5.308E-90	756	0.475	0.479	P10688.pdb.gz	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
7	AFDB:F1QJ13	0.894	0.887	5.872E-90	769	0.453	0.449	F1QJ13.pdb.gz	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
8	AFDB:Q8K2J0	0.917	0.890	6.496E-90	785	0.475	0.461	Q8K2J0.pdb.gz	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
9	AFDB:D4A978	0.885	0.857	1.974E-89	788	0.478	0.462	D4A978.pdb.gz	D4A978_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=1 SV=2
10	AFDB:Q8N3E9	0.886	0.857	4.429E-89	789	0.487	0.470	Q8N3E9.pdb.gz	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
11	PDB:4gnkB	0.722	0.716	1.005E-58	769	0.314	0.311	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:1cjyA	0.150	0.180	5.682E-7	633	0.033	0.039	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5iz5B	0.150	0.153	5.517E-6	746	0.030	0.031	5iz5B.pdb.gz
14	PDB:5ixcA	0.143	0.159	7.102E-6	684	0.028	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5izrC	0.138	0.159	9.617E-6	659	0.028	0.032	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:5a50A	0.138	0.560	1.011E-5	165	0.035	0.164	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:5a52A	0.132	0.580	1.302E-5	154	0.035	0.175	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:3pfqA	0.127	0.181	1.370E-5	523	0.039	0.057	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
19	PDB:3nsjA	0.132	0.186	1.594E-5	530	0.035	0.051	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
20	PDB:5iz5A	0.140	0.141	2.511E-5	757	0.026	0.026	5iz5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AGE0	0.0	715	744	0.472	0.484	A0A8I6AGE0_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=4 SV=1
2	C9JEA7	0.0	1568	794	1.000	0.960	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
3	D4A978	0.0	635	762	0.441	0.441	D4A978_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=1 SV=2
4	F1Q5G9	0.0	887	761	0.571	0.572	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
5	F1QJ13	0.0	676	769	0.458	0.454	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
6	P10688	0.0	687	756	0.478	0.481	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
7	P51178	0.0	674	756	0.462	0.466	PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens OX=9606 GN=PLCD1 PE=1 SV=2
8	Q62711	0.0	1142	772	0.735	0.725	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
9	Q8K2J0	0.0	716	785	0.475	0.461	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
10	Q8K3R3	0.0	1150	807	0.747	0.705	PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus OX=10090 GN=Plcd4 PE=1 SV=2
11	Q8N3E9	0.0	724	789	0.483	0.466	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
12	Q8R3B1	0.0	681	756	0.476	0.480	PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus OX=10090 GN=Plcd1 PE=1 SV=2
13	Q9BRC7	0.0	1586	762	1.000	1.000	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
14	Q86YW0	1.23e-171	508	608	0.354	0.444	PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens OX=9606 GN=PLCZ1 PE=1 SV=1
15	Q9UPR0	6.08e-171	523	1127	0.388	0.263	PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2
16	Q8K394	1.31e-170	523	1128	0.386	0.261	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
17	H2LIC9	6.26e-165	493	659	0.341	0.395	H2LIC9_ORYLA Phosphoinositide phospholipase C OS=Oryzias latipes OX=8090 GN=PLCZ1 PE=4 SV=2
18	Q5FX52	3.09e-164	491	645	0.349	0.412	PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus OX=10116 GN=Plcz1 PE=2 SV=1
19	Q8K4D7	4.54e-164	490	647	0.345	0.406	PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus OX=10090 GN=Plcz1 PE=1 SV=1
20	Q15111	6.34e-157	486	1095	0.379	0.264	PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	8.3e-14	63.1	C2 domain
2	PF00036 EF-hand_1	2.1e-05	34.8	EF hand
3	PF14788 EF-hand_10	1.8e-21	87.1	EF hand
4	PF13202 EF-hand_5	0.0002	31.9	EF hand
5	PF13405 EF-hand_6	0.00032	31.3	EF-hand domain
6	PF13499 EF-hand_7	1.6e-06	39.8	EF-hand domain pair
7	PF13833 EF-hand_8	18	16.6	EF-hand domain pair
8	PF09279 EF-hand_like	6.8e-32	121.1	Phosphoinositide-specific phospholipase C, efhand-like
9	PF03009 GDPD	3.7	18.8	Glycerophosphoryl diester phosphodiesterase family
10	PF00169 PH	0.00059	31.7	PH domain
11	PF16457 PH_12	5.8	18.9	Pleckstrin homology domain
12	PF00388 PI-PLC-X	1.9e-61	217.4	Phosphatidylinositol-specific phospholipase C, X domain
13	PF00387 PI-PLC-Y	2.5e-39	145.5	Phosphatidylinositol-specific phospholipase C, Y domain
14	PF00496 SBP_bac_5	4.5e+02	11.2	Bacterial extracellular solute-binding proteins, family 5 Middle
15	PF16997 Wap1	32	15.1	Wap1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388631

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373399	0.946	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
2	9606.ENSP00000357883	0.940	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
3	9606.ENSP00000265382	0.931	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
4	9606.ENSP00000466363	0.928	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
5	9606.ENSP00000347032	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
6	9606.ENSP00000365757	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
7	9606.ENSP00000482548	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
8	9606.ENSP00000363435	0.847	Inositol 1,4,5-trisphosphate receptor type 3
9	9606.ENSP00000306253	0.846	Inositol 1,4,5-trisphosphate receptor type 1
10	9606.ENSP00000305355	0.845	Protein kinase C beta type
11	9606.ENSP00000370744	0.838	Inositol 1,4,5-trisphosphate receptor type 2
12	9606.ENSP00000360777	0.833	72 kDa inositol polyphosphate 5-phosphatase
13	9606.ENSP00000408695	0.823	Protein kinase C alpha type
14	9606.ENSP00000263431	0.815	Protein kinase C gamma type
15	9606.ENSP00000430344	0.811	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
16	9606.ENSP00000479636	0.811	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
17	9606.ENSP00000362115	0.804	Type II inositol 1,4,5-trisphosphate 5-phosphatase
18	9606.ENSP00000288490	0.790	Diacylglycerol kinase iota
19	9606.ENSP00000347792	0.789	Synaptojanin-2
20	9606.ENSP00000360154	0.784	Inositol polyphosphate 5-phosphatase OCRL-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042578	0.996	phosphoric ester hydrolase activity
GO:0030234	0.995	enzyme regulator activity
GO:0001965	0.992	G-protein alpha-subunit binding
GO:0060589	0.991	nucleoside-triphosphatase regulator activity
GO:0004629	0.985	phospholipase C activity
GO:0030695	0.966	GTPase regulator activity
GO:0004435	0.852	phosphatidylinositol phospholipase C activity
GO:0140677	0.821	molecular function activator activity
GO:0140678	0.684	molecular function inhibitor activity
GO:0043167	0.590	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0009987	0.999	cellular process
GO:0007154	0.991	cell communication
GO:0050794	0.990	regulation of cellular process
GO:0023052	0.989	signaling
GO:0050896	0.980	response to stimulus
GO:0051716	0.925	cellular response to stimulus
GO:0007165	0.915	signal transduction
GO:0071704	0.797	organic substance metabolic process
GO:0044238	0.779	primary metabolic process
GO:0044237	0.772	cellular metabolic process
GO:0006796	0.730	phosphate-containing compound metabolic process
GO:0035556	0.704	intracellular signal transduction
GO:0006629	0.678	lipid metabolic process
GO:0044255	0.625	cellular lipid metabolic process
GO:0019637	0.581	organophosphate metabolic process
GO:0006644	0.560	phospholipid metabolic process
GO:0046486	0.543	glycerolipid metabolic process
GO:0006650	0.528	glycerophospholipid metabolic process
GO:0007264	0.468	small GTPase mediated signal transduction
GO:0046488	0.404	phosphatidylinositol metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005886	0.975	plasma membrane
GO:0012505	0.974	endomembrane system
GO:0005783	0.849	endoplasmic reticulum
GO:0005789	0.365	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.996	Acting on ester bonds.
EC:3.1.4.-	0.987	Phosphoric diester hydrolases.
RHEA:33179	0.852	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.852	phosphoinositide phospholipase C.

[back to server]