StarFunc result for job id Q9BRG1

User Input

>input (176 residues)
MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLF
NNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQ
NNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1X3	0.988	0.988	4.296E-35	176	1.000	1.000	A0A024R1X3.pdb.gz
2	PDB:3cuqC	0.922	0.937	4.937E-29	173	0.983	1.000	3cuqC.pdb.gz
3	AFDB:Q55GD9	0.830	0.761	9.734E-21	194	0.381	0.345	Q55GD9.pdb.gz	VPS25_DICDI Vacuolar protein-sorting-associated protein 25 OS=Dictyostelium discoideum OX=44689 GN=vps25 PE=1 SV=1
4	AFDB:Q7JXV9	0.829	0.837	2.382E-20	174	0.420	0.425	Q7JXV9.pdb.gz	VPS25_DROME Vacuolar protein-sorting-associated protein 25 OS=Drosophila melanogaster OX=7227 GN=Vps25 PE=1 SV=1
5	AFDB:Q8VZC9	0.710	0.701	4.384E-17	179	0.352	0.346	Q8VZC9.pdb.gz	VPS25_ARATH Vacuolar protein sorting-associated protein 25 OS=Arabidopsis thaliana OX=3702 GN=VPS25 PE=1 SV=1
6	AFDB:P47142	0.760	0.676	6.425E-16	202	0.312	0.272	P47142.pdb.gz	VPS25_YEAST Vacuolar protein-sorting-associated protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS25 PE=1 SV=1
7	AFDB:O74967	0.709	0.712	9.756E-16	175	0.347	0.349	O74967.pdb.gz	VPS25_SCHPO Vacuolar protein-sorting-associated protein 25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps25 PE=3 SV=1
8	AFDB:Q5AK78	0.703	0.643	1.710E-14	196	0.330	0.296	Q5AK78.pdb.gz	Q5AK78_CANAL ESCRT-II subunit protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CSU57 PE=3 SV=1
9	PDB:1w7pB	0.697	0.678	1.389E-10	182	0.312	0.302	1w7pB.pdb.gz
10	PDB:1xb4D	0.655	0.734	8.228E-8	154	0.278	0.318	1xb4D.pdb.gz
11	AFDB:Q38BD1	0.487	0.401	4.675E-7	234	0.273	0.205	Q38BD1.pdb.gz	Q38BD1_TRYB2 Dolicholphosphate-mannose synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2510 PE=4 SV=1
12	AFDB:Q8WUX9	0.582	0.266	1.580E-5	453	0.227	0.088	Q8WUX9.pdb.gz	CHMP7_HUMAN Charged multivesicular body protein 7 OS=Homo sapiens OX=9606 GN=CHMP7 PE=1 SV=1
13	AFDB:Q86K93	0.578	0.252	1.718E-4	477	0.148	0.055	Q86K93.pdb.gz	CHMP7_DICDI Charged multivesicular body protein 7 OS=Dictyostelium discoideum OX=44689 GN=chmp7 PE=3 SV=1
14	PDB:8d0bB	0.336	0.182	1.085E-3	362	0.125	0.061	8d0bB.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
15	PDB:6w6wC	0.308	0.186	8.754E-3	323	0.165	0.090	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
16	PDB:3cuqA	0.360	0.305	1.411E-2	219	0.165	0.132	3cuqA.pdb.gz
17	PDB:1w7pD	0.361	0.369	1.590E-2	171	0.108	0.111	1w7pD.pdb.gz
18	PDB:1ldjA	0.343	0.094	2.274E-2	725	0.051	0.012	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
19	PDB:5v8f4	0.356	0.093	2.562E-2	741	0.057	0.013	5v8f4.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
20	PDB:1u5tA	0.317	0.275	2.887E-2	213	0.114	0.094	1u5tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRG1	1.28e-130	365	176	1.000	1.000	VPS25_HUMAN Vacuolar protein-sorting-associated protein 25 OS=Homo sapiens OX=9606 GN=VPS25 PE=1 SV=1
2	Q9CQ80	2.70e-129	361	176	0.989	0.989	VPS25_MOUSE Vacuolar protein-sorting-associated protein 25 OS=Mus musculus OX=10090 GN=Vps25 PE=1 SV=1
3	K7ENE3	2.51e-74	220	108	0.614	1.000	K7ENE3_HUMAN Vacuolar protein-sorting-associated protein 25 (Fragment) OS=Homo sapiens OX=9606 GN=VPS25 PE=1 SV=1
4	Q7JXV9	1.43e-49	159	174	0.420	0.425	VPS25_DROME Vacuolar protein-sorting-associated protein 25 OS=Drosophila melanogaster OX=7227 GN=Vps25 PE=1 SV=1
5	Q55GD9	2.77e-41	139	194	0.398	0.361	VPS25_DICDI Vacuolar protein-sorting-associated protein 25 OS=Dictyostelium discoideum OX=44689 GN=vps25 PE=1 SV=1
6	Q8VZC9	1.42e-34	121	179	0.358	0.352	VPS25_ARATH Vacuolar protein sorting-associated protein 25 OS=Arabidopsis thaliana OX=3702 GN=VPS25 PE=1 SV=1
7	O74967	3.52e-27	102	175	0.347	0.349	VPS25_SCHPO Vacuolar protein-sorting-associated protein 25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps25 PE=3 SV=1
8	Q5AK78	5.49e-26	100	196	0.330	0.296	Q5AK78_CANAL ESCRT-II subunit protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CSU57 PE=3 SV=1
9	P47142	1.08e-22	91.7	202	0.318	0.277	VPS25_YEAST Vacuolar protein-sorting-associated protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS25 PE=1 SV=1
10	Q38BD1	5.72e-06	47.0	234	0.136	0.103	Q38BD1_TRYB2 Dolicholphosphate-mannose synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2510 PE=4 SV=1
11	P0A6V8	0.13	34.7	321	0.085	0.047	GLK_ECOLI Glucokinase OS=Escherichia coli (strain K12) OX=83333 GN=glk PE=1 SV=1
12	A0A8I5ZU83	1.9	31.6	26931	0.170	0.001	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
13	A0A8I5ZUN3	2.0	31.6	35375	0.170	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
14	Q8WZ42	3.3	30.8	34350	0.170	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
15	Q9S750	3.5	30.0	238	0.091	0.067	KITHA_ARATH Thymidine kinase a OS=Arabidopsis thaliana OX=3702 GN=TK1A PE=1 SV=1
16	P73722	4.0	30.0	203	0.148	0.128	LEXA_SYNY3 Transcription regulator LexA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=lexA PE=1 SV=1
17	P90916	4.4	30.0	417	0.080	0.034	LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans OX=6239 GN=lin-53 PE=1 SV=2
18	A2ASS6	4.6	30.4	35213	0.170	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
19	D4GXP4	6.8	29.6	582	0.170	0.052	Y1357_HALVD Putative transcriptional regulator HVO_1357 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=HVO_1357 PE=3 SV=1
20	O94284	7.8	29.3	459	0.080	0.031	HMT2_SCHPO Sulfide:quinone oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hmt2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05871 ESCRT-II	8.7e-51	183.3	ESCRT-II complex subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014357

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003338	0.998	Vacuolar-sorting protein SNF8
2	61853.ENSNLEP00000019132	0.998	Vacuolar protein sorting 36 homolog (S. cerevisiae)
3	61853.ENSNLEP00000019231	0.998	Charged multivesicular body protein 6
4	61853.ENSNLEP00000013013	0.983	VPS28, ESCRT-I subunit
5	61853.ENSNLEP00000013630	0.981	Charged multivesicular body protein 2A
6	61853.ENSNLEP00000012220	0.976	Charged multivesicular body protein 4B
7	61853.ENSNLEP00000016808	0.973	Hepatocyte growth factor-regulated tyrosine kinase substrate
8	61853.ENSNLEP00000021594	0.972	Tumor susceptibility 101
9	61853.ENSNLEP00000003468	0.969	Charged multivesicular body protein 3
10	61853.ENSNLEP00000019327	0.957	Charged multivesicular body protein 7
11	61853.ENSNLEP00000014327	0.950	Charged multivesicular body protein 2B
12	61853.ENSNLEP00000002726	0.947	VPS37B, ESCRT-I subunit
13	61853.ENSNLEP00000006044	0.945	Ubiquitin associated protein 1
14	61853.ENSNLEP00000006998	0.940	Multivesicular body subunit 12A
15	61853.ENSNLEP00000003142	0.933	VPS37A, ESCRT-I subunit
16	61853.ENSNLEP00000015314	0.925	Signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
17	61853.ENSNLEP00000002373	0.923	VPS37C, ESCRT-I subunit
18	61853.ENSNLEP00000021120	0.918	Multivesicular body subunit 12B
19	61853.ENSNLEP00000010819	0.915	Vacuolar protein sorting 37 homolog D (S. cerevisiae)
20	61853.ENSNLEP00000013744	0.907	Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	0.999	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.987	cellular metabolic process
GO:0050789	0.986	regulation of biological process
GO:0071840	0.985	cellular component organization or biogenesis
GO:0050794	0.984	regulation of cellular process
GO:0006914	0.984	autophagy
GO:0006996	0.983	organelle organization
GO:0016050	0.972	vesicle organization
GO:0048519	0.965	negative regulation of biological process
GO:0048523	0.964	negative regulation of cellular process
GO:0031323	0.963	regulation of cellular metabolic process
GO:0016236	0.949	macroautophagy
GO:0009966	0.946	regulation of signal transduction
GO:0051246	0.912	regulation of protein metabolic process
GO:0051172	0.896	negative regulation of nitrogen compound metabolic process
GO:0031324	0.896	negative regulation of cellular metabolic process
GO:0010605	0.894	negative regulation of macromolecule metabolic process
GO:0010256	0.870	endomembrane system organization
GO:0022607	0.870	cellular component assembly
GO:0007032	0.851	endosome organization
GO:0031400	0.837	negative regulation of protein modification process
GO:0042326	0.800	negative regulation of phosphorylation
GO:0001932	0.772	regulation of protein phosphorylation
GO:1901184	0.730	regulation of ERBB signaling pathway
GO:0070925	0.699	organelle assembly
GO:0001933	0.696	negative regulation of protein phosphorylation
GO:0050730	0.690	regulation of peptidyl-tyrosine phosphorylation
GO:0050732	0.663	negative regulation of peptidyl-tyrosine phosphorylation
GO:0071704	0.559	organic substance metabolic process
GO:0033673	0.559	negative regulation of kinase activity
GO:0051179	0.541	localization
GO:0042058	0.541	regulation of epidermal growth factor receptor signaling pathway
GO:0044238	0.540	primary metabolic process
GO:0006807	0.534	nitrogen compound metabolic process
GO:0051234	0.523	establishment of localization
GO:0016192	0.498	vesicle-mediated transport
GO:0043170	0.477	macromolecule metabolic process
GO:0051603	0.374	proteolysis involved in protein catabolic process
GO:0048585	0.370	negative regulation of response to stimulus
GO:0006511	0.358	ubiquitin-dependent protein catabolic process
GO:0009968	0.347	negative regulation of signal transduction
GO:0043162	0.329	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0010469	0.317	regulation of signaling receptor activity
GO:0051641	0.309	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0005829	0.992	cytosol
GO:0016020	0.989	membrane
GO:0005634	0.982	nucleus
GO:0005576	0.977	extracellular region
GO:0032991	0.973	protein-containing complex
GO:0031090	0.953	organelle membrane
GO:0070062	0.952	extracellular exosome
GO:0005886	0.925	plasma membrane
GO:0010008	0.916	endosome membrane
GO:0098796	0.903	membrane protein complex
GO:0036452	0.897	ESCRT complex
GO:0005739	0.441	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]