StarFunc result for job id Q9BRJ9

User Input

>input (268 residues)
MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGT
LRDPRAPSVGRRGARSSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSL
TKIETLRLAIRYIGHLSAVLGLSEESLQRRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQA
EGQGQGRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPPS
PLLPGDVLALLETWMPLSPLEWLPEEPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRJ9	0.999	0.999	2.013E-38	268	1.000	1.000	Q9BRJ9.pdb.gz	MESP1_HUMAN Mesoderm posterior protein 1 OS=Homo sapiens OX=9606 GN=MESP1 PE=1 SV=1
2	AFDB:Q0VG99	0.320	0.223	1.417E-16	397	0.545	0.368	Q0VG99.pdb.gz	MESP2_HUMAN Mesoderm posterior protein 2 OS=Homo sapiens OX=9606 GN=MESP2 PE=1 SV=2
3	AFDB:O08574	0.323	0.241	1.754E-12	370	0.437	0.316	O08574.pdb.gz	MESP2_MOUSE Mesoderm posterior protein 2 OS=Mus musculus OX=10090 GN=Mesp2 PE=1 SV=1
4	AFDB:I2AVW0	0.303	0.329	1.365E-8	244	0.295	0.324	I2AVW0.pdb.gz	I2AVW0_DANRE Mesoderm posterior bb OS=Danio rerio OX=7955 GN=mesp-bb PE=2 SV=1
5	AFDB:B3DFN8	0.217	0.258	7.467E-6	223	0.243	0.291	B3DFN8.pdb.gz
6	AFDB:Q6PFG8	0.179	0.176	3.348E-3	273	0.213	0.209	Q6PFG8.pdb.gz	OLIG3_MOUSE Oligodendrocyte transcription factor 3 OS=Mus musculus OX=10090 GN=Olig3 PE=2 SV=1
7	AFDB:Q7RTU1	0.200	0.250	7.933E-3	214	0.172	0.215	Q7RTU1.pdb.gz	TCF23_HUMAN Transcription factor 23 OS=Homo sapiens OX=9606 GN=TCF23 PE=1 SV=1
8	AFDB:Q92858	0.189	0.145	7.933E-3	354	0.213	0.161	Q92858.pdb.gz	ATOH1_HUMAN Transcription factor ATOH1 OS=Homo sapiens OX=9606 GN=ATOH1 PE=2 SV=1
9	AFDB:A8WIQ8	0.183	0.180	9.681E-3	273	0.231	0.227	A8WIQ8.pdb.gz
10	AFDB:G3V612	0.178	0.149	1.181E-2	323	0.209	0.173	G3V612.pdb.gz	G3V612_RAT Oligodendrocyte transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Olig2 PE=1 SV=1
11	PDB:7edxc	0.131	0.211	1.616	127	0.071	0.150	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
12	PDB:4v6xCh	0.091	0.160	2.571	123	0.056	0.122	4v6xCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:7kahA	0.116	0.076	2.571	441	0.034	0.020	7kahA.pdb.gz
14	PDB:3v9rA	0.125	0.297	2.747	88	0.041	0.125	3v9rA.pdb.gz
15	PDB:2bskC	0.115	0.302	3.828	79	0.034	0.114	2bskC.pdb.gz
16	PDB:4v8mAL	0.094	0.169	4.372	126	0.049	0.103	4v8mAL.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
17	PDB:6n3qA	0.123	0.089	4.372	391	0.034	0.023	6n3qA.pdb.gz
18	PDB:3ojaA	0.130	0.080	4.672	482	0.045	0.025	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
19	PDB:4v6wCC	0.108	0.080	4.992	392	0.063	0.043	4v6wCC.pdb.gz	Structures of the human and Drosophila 80S ribosome.
20	PDB:6qzpSR	0.097	0.156	5.335	135	0.067	0.133	6qzpSR.pdb.gz	Visualization of chemical modifications in the human 80S ribosome structure.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRJ9	0.0	513	268	1.000	1.000	MESP1_HUMAN Mesoderm posterior protein 1 OS=Homo sapiens OX=9606 GN=MESP1 PE=1 SV=1
2	P97309	4.82e-76	233	243	0.616	0.679	MESP1_MOUSE Mesoderm posterior protein 1 OS=Mus musculus OX=10090 GN=Mesp1 PE=2 SV=2
3	Q0VG99	9.71e-57	188	397	0.463	0.312	MESP2_HUMAN Mesoderm posterior protein 2 OS=Homo sapiens OX=9606 GN=MESP2 PE=1 SV=2
4	O08574	7.55e-44	154	370	0.340	0.246	MESP2_MOUSE Mesoderm posterior protein 2 OS=Mus musculus OX=10090 GN=Mesp2 PE=1 SV=1
5	I2AVW0	2.68e-28	110	244	0.220	0.242	I2AVW0_DANRE Mesoderm posterior bb OS=Danio rerio OX=7955 GN=mesp-bb PE=2 SV=1
6	Q9IB69	1.46e-25	102	236	0.205	0.233	Q9IB69_DANRE BHLH transcription factor Mesp-b OS=Danio rerio OX=7955 GN=mesp-b PE=2 SV=1
7	I2AVV9	2.80e-23	97.1	240	0.198	0.221	I2AVV9_DANRE Mesoderm posterior ab OS=Danio rerio OX=7955 GN=mesp2 PE=2 SV=1
8	Q9IB70	2.26e-21	91.3	223	0.175	0.211	Q9IB70_DANRE BHLH transcription factor Mesp-a OS=Danio rerio OX=7955 GN=mesp-a PE=2 SV=1
9	Q9JK54	1.01e-16	78.2	188	0.187	0.266	MSGN1_MOUSE Mesogenin-1 OS=Mus musculus OX=10090 GN=Msgn1 PE=2 SV=1
10	A6NI15	1.94e-16	77.4	193	0.142	0.197	MSGN1_HUMAN Mesogenin-1 OS=Homo sapiens OX=9606 GN=MSGN1 PE=1 SV=1
11	Q90ZL1	1.25e-15	73.6	131	0.131	0.267	MSGN1_DANRE Mesogenin-1 OS=Danio rerio OX=7955 GN=msgn1 PE=2 SV=1
12	Q8SYH4	1.51e-09	58.2	178	0.108	0.163	Q8SYH4_DROME RE59356p OS=Drosophila melanogaster OX=7227 GN=sage PE=2 SV=1
13	Q9VHG3	4.37e-09	58.2	268	0.108	0.108	Q9VHG3_DROME IP14615p OS=Drosophila melanogaster OX=7227 GN=sage PE=2 SV=1
14	Q9Y4Z2	1.70e-07	52.8	214	0.157	0.196	NGN3_HUMAN Neurogenin-3 OS=Homo sapiens OX=9606 GN=NEUROG3 PE=1 SV=2
15	O16867	1.79e-07	53.9	398	0.175	0.118	TAP_DROME Basic helix-loop-helix neural transcription factor TAP OS=Drosophila melanogaster OX=7227 GN=tap PE=1 SV=2
16	O08718	1.91e-07	52.8	214	0.146	0.182	O08718_RAT Neurogenin 3 OS=Rattus norvegicus OX=10116 GN=Neurog3 PE=4 SV=1
17	P70661	2.02e-07	52.8	214	0.146	0.182	NGN3_MOUSE Neurogenin-3 OS=Mus musculus OX=10090 GN=Neurog3 PE=1 SV=1
18	Q20561	2.12e-07	51.2	147	0.119	0.218	HLH13_CAEEL Helix-loop-helix protein 13 OS=Caenorhabditis elegans OX=6239 GN=hlh-13 PE=2 SV=1
19	Q60756	2.99e-07	52.0	195	0.104	0.144	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
20	Q10574	3.11e-07	50.8	142	0.149	0.282	LIN32_CAEEL Protein lin-32 OS=Caenorhabditis elegans OX=6239 GN=lin-32 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1.6e-09	48.9	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300057

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327758	0.722	Homeobox protein Nkx-2.5
2	9606.ENSP00000309913	0.683	T-box transcription factor TBX5
3	9606.ENSP00000387699	0.676	Cyclic AMP-responsive element-binding protein 1
4	9606.ENSP00000326371	0.660	Forkhead box protein C2
5	9606.ENSP00000297316	0.646	Transcription factor SOX-17
6	9606.ENSP00000370256	0.635	Forkhead box protein C1
7	9606.ENSP00000334458	0.625	Transcription factor GATA-4
8	9606.ENSP00000442439	0.614	Homeobox protein MIXL1
9	9606.ENSP00000222725	0.609	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
10	9606.ENSP00000230658	0.609	Insulin gene enhancer protein ISL-1
11	9606.ENSP00000276173	0.600	Protein ripply1
12	9606.ENSP00000296839	0.598	Forkhead box protein Q1
13	9606.ENSP00000352565	0.595	Heart- and neural crest derivatives-expressed protein 2
14	9606.ENSP00000304286	0.591	Forkhead box protein I1
15	9606.ENSP00000386398	0.581	Putative ankyrin repeat domain-containing protein 30B-like
16	9606.ENSP00000245323	0.575	Ephrin-B2
17	9606.ENSP00000367714	0.569	Transcription factor HES-5
18	9606.ENSP00000340874	0.563	Myocyte-specific enhancer factor 2C
19	9606.ENSP00000262188	0.554	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
20	9606.ENSP00000355718	0.546	Delta-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000977	0.847	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.829	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.609	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.508	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.437	DNA-binding transcription activator activity
GO:0001228	0.386	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0007275	0.995	multicellular organism development
GO:0009987	0.993	cellular process
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0048518	0.979	positive regulation of biological process
GO:0009653	0.977	anatomical structure morphogenesis
GO:0006357	0.974	regulation of transcription by RNA polymerase II
GO:0048731	0.973	system development
GO:0048522	0.973	positive regulation of cellular process
GO:0009888	0.939	tissue development
GO:0007507	0.935	heart development
GO:0030154	0.934	cell differentiation
GO:0010604	0.925	positive regulation of macromolecule metabolic process
GO:0003007	0.924	heart morphogenesis
GO:0045893	0.919	positive regulation of DNA-templated transcription
GO:0045944	0.912	positive regulation of transcription by RNA polymerase II
GO:0003205	0.894	cardiac chamber development
GO:0061061	0.858	muscle structure development
GO:0003206	0.847	cardiac chamber morphogenesis
GO:0035051	0.841	cardiocyte differentiation
GO:0060537	0.822	muscle tissue development
GO:0001944	0.814	vasculature development
GO:0003231	0.796	cardiac ventricle development
GO:0001568	0.757	blood vessel development
GO:0048646	0.750	anatomical structure formation involved in morphogenesis
GO:0014706	0.740	striated muscle tissue development
GO:0042692	0.684	muscle cell differentiation
GO:0051145	0.610	smooth muscle cell differentiation
GO:0048519	0.608	negative regulation of biological process
GO:0003230	0.552	cardiac atrium development
GO:0060429	0.505	epithelium development
GO:0048523	0.495	negative regulation of cellular process
GO:0048738	0.492	cardiac muscle tissue development
GO:0050793	0.460	regulation of developmental process
GO:0051239	0.385	regulation of multicellular organismal process
GO:0060976	0.362	coronary vasculature development
GO:0003208	0.351	cardiac ventricle morphogenesis
GO:0050896	0.338	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.421	nuclear lumen
GO:0005654	0.404	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]