StarFunc result for job id Q9BRP0

User Input

>input (275 residues)
MPKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSS
SAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQRPVARSKIKFTTGTCSDSVVHS
CDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVC
NKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGS
SFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRP0	1.000	1.000	4.142E-49	275	1.000	1.000	Q9BRP0.pdb.gz	OVOL2_HUMAN Transcription factor Ovo-like 2 OS=Homo sapiens OX=9606 GN=OVOL2 PE=1 SV=1
2	AFDB:Q8CIV7	0.613	0.615	6.303E-40	274	0.851	0.854	Q8CIV7.pdb.gz	OVOL2_MOUSE Transcription factor Ovo-like 2 OS=Mus musculus OX=10090 GN=Ovol2 PE=1 SV=2
3	AFDB:O14753	0.371	0.381	1.888E-21	267	0.513	0.528	O14753.pdb.gz	OVOL1_HUMAN Putative transcription factor Ovo-like 1 OS=Homo sapiens OX=9606 GN=OVOL1 PE=1 SV=3
4	AFDB:G5EDU6	0.317	0.311	7.856E-17	280	0.389	0.382	G5EDU6.pdb.gz	OVOLH_CAEEL Transcription factor ovo-like homolog lin-48 OS=Caenorhabditis elegans OX=6239 GN=lin-48 PE=1 SV=1
5	AFDB:Q96GC6	0.301	0.137	8.751E-11	653	0.204	0.086	Q96GC6.pdb.gz	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2
6	AFDB:Q95RA7	0.267	0.169	1.208E-10	447	0.225	0.139	Q95RA7.pdb.gz	Q95RA7_DROME LD47721p OS=Drosophila melanogaster OX=7227 GN=CG14710 PE=2 SV=1
7	AFDB:A0A024RC47	0.264	0.201	2.792E-10	368	0.207	0.155	A0A024RC47.pdb.gz
8	AFDB:Q147U1	0.274	0.146	2.978E-10	533	0.222	0.114	Q147U1.pdb.gz	ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens OX=9606 GN=ZNF846 PE=1 SV=2
9	AFDB:I7HJS4	0.310	0.193	3.388E-10	458	0.207	0.124	I7HJS4.pdb.gz	ZN683_MOUSE Tissue-resident T-cell transcription regulator protein ZNF683 OS=Mus musculus OX=10090 GN=Znf683 PE=2 SV=1
10	AFDB:Q96H86	0.245	0.173	3.388E-10	408	0.200	0.135	Q96H86.pdb.gz	ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens OX=9606 GN=ZNF764 PE=1 SV=2
11	PDB:3w5kB	0.181	0.309	1.832E-4	110	0.135	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5apny	0.099	0.128	2.199E-1	211	0.091	0.118	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
13	PDB:2g9wA	0.114	0.173	1.337	119	0.069	0.160	2g9wA.pdb.gz
14	PDB:4z4kA	0.099	0.097	2.099	282	0.051	0.050	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
15	PDB:7pmkQ	0.063	0.029	2.239	766	0.069	0.025	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:6wjvA	0.060	0.016	2.388	1951	0.044	0.006	6wjvA.pdb.gz
17	PDB:4c2mI	0.044	0.091	2.547	124	0.022	0.048	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
18	PDB:6ft6I	0.094	0.148	2.898	131	0.069	0.145	6ft6I.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
19	PDB:2airB	0.072	0.125	3.296	153	0.018	0.033	2airB.pdb.gz	T-State Active Site of Aspartate Transcarbamylase: Crystal Structure of the Carbamyl Phosphate and l-Alanosine Ligated Enzyme
20	PDB:1d1rA	0.066	0.155	3.516	83	0.051	0.169	1d1rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRP0	0.0	568	275	1.000	1.000	OVOL2_HUMAN Transcription factor Ovo-like 2 OS=Homo sapiens OX=9606 GN=OVOL2 PE=1 SV=1
2	Q8CIV7	5.05e-172	478	274	0.876	0.880	OVOL2_MOUSE Transcription factor Ovo-like 2 OS=Mus musculus OX=10090 GN=Ovol2 PE=1 SV=2
3	O14753	1.56e-88	266	267	0.513	0.528	OVOL1_HUMAN Putative transcription factor Ovo-like 1 OS=Homo sapiens OX=9606 GN=OVOL1 PE=1 SV=3
4	Q9WTJ2	3.61e-88	265	267	0.502	0.517	OVOL1_MOUSE Putative transcription factor Ovo-like 1 OS=Mus musculus OX=10090 GN=Ovol1 PE=2 SV=1
5	F8W4G4	1.94e-75	234	319	0.495	0.426	F8W4G4_DANRE Ovo-like zinc finger 1a OS=Danio rerio OX=7955 GN=ovol1 PE=4 SV=1
6	A9JSU5	1.27e-67	212	256	0.356	0.383	A9JSU5_DANRE Transcription factor Ovo-like 1 OS=Danio rerio OX=7955 GN=ovol1 PE=2 SV=1
7	A7E2L3	1.15e-62	199	253	0.320	0.348	A7E2L3_DANRE Uncharacterized protein LOC100124596 OS=Danio rerio OX=7955 GN=zgc:171929 PE=2 SV=1
8	G5EDU6	3.88e-60	194	280	0.331	0.325	OVOLH_CAEEL Transcription factor ovo-like homolog lin-48 OS=Caenorhabditis elegans OX=6239 GN=lin-48 PE=1 SV=1
9	P51521	7.61e-56	195	1351	0.327	0.067	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2
10	Q99MD8	2.04e-20	92.8	610	0.185	0.084	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
11	Q9NPC7	7.15e-20	91.3	610	0.182	0.082	MYNN_HUMAN Myoneurin OS=Homo sapiens OX=9606 GN=MYNN PE=1 SV=1
12	G5EDE1	2.81e-17	82.4	336	0.160	0.131	GFI1H_CAEEL Zinc finger protein GFI1 homolog pag-3 OS=Caenorhabditis elegans OX=6239 GN=pag-3 PE=1 SV=1
13	Q5J2I5	4.22e-17	82.8	478	0.218	0.126	Q5J2I5_DANRE Bloody fingers OS=Danio rerio OX=7955 GN=zgc:123026 PE=2 SV=1
14	Q6ZSB9	7.00e-17	82.4	765	0.145	0.052	ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens OX=9606 GN=ZBTB49 PE=1 SV=3
15	Q9VDQ4	7.70e-17	82.0	439	0.160	0.100	Q9VDQ4_DROME Trade embargo OS=Drosophila melanogaster OX=7227 GN=trem PE=1 SV=2
16	F1QWQ9	1.03e-16	82.0	568	0.138	0.067	F1QWQ9_DANRE PR domain zinc finger protein 14 isoform X1 OS=Danio rerio OX=7955 GN=fc16b12 PE=4 SV=1
17	Q6XSK8	1.13e-16	81.6	517	0.138	0.074	Q6XSK8_DANRE PR domain zinc finger protein 14 OS=Danio rerio OX=7955 GN=wu:fc16b12 PE=4 SV=2
18	O70237	2.36e-16	79.7	330	0.156	0.130	GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus OX=10090 GN=Gfi1b PE=1 SV=1
19	P10073	2.51e-16	80.5	491	0.156	0.088	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
20	Q60821	2.81e-16	80.9	794	0.156	0.054	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	67	15.0	FYVE zinc finger
2	PF04032 Rpr2	9.4e+02	11.5	RNAse P Rpr2/Rpp21/SNM1 subunit domain
3	PF00096 zf-C2H2	1.1e-13	61.9	Zinc finger, C2H2 type
4	PF18868 zf-C2H2_3rep	0.0016	30.6	Zinc finger C2H2-type, 3 repeats
5	PF13894 zf-C2H2_4	5.1e-07	41.0	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	0.065	24.5	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	5.7	18.6	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	3.2e-13	60.6	Zinc-finger double domain
9	PF13909 zf-H2C2_5	1.6	19.8	C2H2-type zinc-finger domain
10	PF12874 zf-met	7.3	18.3	Zinc-finger of C2H2 type
11	PF18387 zf_C2H2_ZHX	7.8	17.6	Zinc-fingers and homeoboxes C2H2 finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278780

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251808	0.872	Grainyhead-like protein 2 homolog
2	9606.ENSP00000384524	0.848	ETS translocation variant 2
3	9606.ENSP00000366828	0.670	DNA-directed RNA polymerase III subunit RPC6
4	9606.ENSP00000405738	0.644	Epithelial splicing regulatory protein 1
5	9606.ENSP00000331040	0.628	Oligodendrocyte transcription factor 2
6	9606.ENSP00000310620	0.616	Sorting nexin-32
7	9606.ENSP00000366998	0.572	Sorting nexin-5
8	9606.ENSP00000264515	0.569	Retinoblastoma-binding protein 5
9	9606.ENSP00000317836	0.543	Proline-rich protein 15
10	9606.ENSP00000261769	0.540	Cadherin-1
11	9606.ENSP00000324693	0.540	Grainyhead-like protein 1 homolog
12	9606.ENSP00000354376	0.528	Ras-related protein Rab-25
13	9606.ENSP00000409544	0.515	Claudin-4
14	9606.ENSP00000418748	0.507	Epithelial splicing regulatory protein 2
15	9606.ENSP00000338728	0.505	Girdin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0001067	0.986	transcription regulatory region nucleic acid binding
GO:0000976	0.976	transcription cis-regulatory region binding
GO:0000981	0.943	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001227	0.635	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.586	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.484	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.990	regulation of cellular process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0080090	0.983	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0031323	0.976	regulation of cellular metabolic process
GO:0048523	0.947	negative regulation of cellular process
GO:0051252	0.937	regulation of RNA metabolic process
GO:0031326	0.929	regulation of cellular biosynthetic process
GO:0010556	0.925	regulation of macromolecule biosynthetic process
GO:0009987	0.914	cellular process
GO:1903506	0.906	regulation of nucleic acid-templated transcription
GO:0006355	0.902	regulation of DNA-templated transcription
GO:0048518	0.881	positive regulation of biological process
GO:0032502	0.853	developmental process
GO:0048522	0.799	positive regulation of cellular process
GO:0048856	0.773	anatomical structure development
GO:0042127	0.729	regulation of cell population proliferation
GO:0051239	0.705	regulation of multicellular organismal process
GO:0048583	0.684	regulation of response to stimulus
GO:0009893	0.640	positive regulation of metabolic process
GO:0010604	0.621	positive regulation of macromolecule metabolic process
GO:0050793	0.616	regulation of developmental process
GO:0009892	0.591	negative regulation of metabolic process
GO:0009888	0.565	tissue development
GO:0010646	0.542	regulation of cell communication
GO:0023051	0.539	regulation of signaling
GO:0045595	0.533	regulation of cell differentiation
GO:0010605	0.502	negative regulation of macromolecule metabolic process
GO:0010717	0.481	regulation of epithelial to mesenchymal transition
GO:0010837	0.478	regulation of keratinocyte proliferation
GO:0045682	0.468	regulation of epidermis development
GO:0006357	0.458	regulation of transcription by RNA polymerase II
GO:0051172	0.342	negative regulation of nitrogen compound metabolic process
GO:0031325	0.332	positive regulation of cellular metabolic process
GO:0051173	0.331	positive regulation of nitrogen compound metabolic process
GO:0009966	0.309	regulation of signal transduction
GO:2000026	0.301	regulation of multicellular organismal development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.557	nuclear lumen
GO:0005654	0.427	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]