StarFunc result for job id Q9BRP7

User Input

>input (624 residues)
MAPRRLLLVGEGNFSFAAALSETLDQSTQLTATCLQRPAELARDPLAWENLQCLRERGID
VRFGVDCTQLADVFELHEREFDQIYFIFPHCGRKAGVAKNRELLAKFFQSCADVLAEEGE
VHVALCRGQGGTPADKPQREWHNSWQVVAMAALGGLILSDVYPFSCKAVAGYKCTGYRSQ
DKSFHVEGALNHIFTRSLPFEGSQPRIFRIKLGNQWFSFPEPEALVGKLNRGFLEAPSCH
PIKTINEKLIAELGKVFPLKRLKCSYPLLPQEGTSVLPFWNCDFLSAAFWISLHEDNSNS
ESLTGGTSQDVEDFLVSFSELSLLKNPGRDGKEEACEGTCGQAKICLRPSLLVHVQDVIE
VPDFLSGSLHILSGPVFQKCHILPFTMPAFHETLFILGVNQNLKDGCLQSLLDHLKGILD
SLLTQTLPESSKLSSLVKFVLQSNGKDYMIRVKTHNFSPDCTEDLIIGSVITSATSVIHK
DQCFVFVSMNLDLLAMLVWCISDWRMLWTFDNRFLKNFVPGKIEPFKSHSLYPPCYVHDV
SFWIDQKKGFDELEFHTVARAVSQDTIISIQFLSRFQHPKTQQVSLCYRLTYQTCDKALT
QQQVASMQSQFRKEIQQHLYVIPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRP7	1.000	1.000	0.000	624	1.000	1.000	Q9BRP7.pdb.gz	FDXA1_HUMAN Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FDXACB1 PE=1 SV=3
2	AFDB:B4DYW0	0.329	0.245	5.580E-42	844	0.377	0.278	B4DYW0.pdb.gz	B4DYW0_HUMAN Mannosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:O74952	0.490	0.697	4.757E-23	429	0.130	0.189	O74952.pdb.gz	SYFM_SCHPO Phenylalanine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mfs1 PE=3 SV=1
4	AFDB:Q99M01	0.483	0.654	6.632E-23	451	0.138	0.191	Q99M01.pdb.gz	SYFM_MOUSE Phenylalanine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Fars2 PE=1 SV=1
5	AFDB:Q94K73	0.476	0.671	1.154E-22	429	0.133	0.193	Q94K73.pdb.gz	SYFM_ARATH Phenylalanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g58140 PE=1 SV=1
6	AFDB:Q6AYQ3	0.473	0.615	1.609E-22	472	0.127	0.167	Q6AYQ3.pdb.gz	SYFM_RAT Phenylalanine--tRNA ligase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fars2 PE=2 SV=1
7	PDB:5mguA	0.467	0.691	1.736E-21	407	0.127	0.194	5mguA.pdb.gz	Kinetic and structural changes in HsmtPheRS, induced by pathogenic mutations in human FARS2.
8	AFDB:P08425	0.437	0.565	2.173E-21	469	0.135	0.179	P08425.pdb.gz	SYFM_YEAST Phenylalanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSF1 PE=1 SV=3
9	AFDB:O95363	0.481	0.652	3.781E-21	451	0.130	0.180	O95363.pdb.gz	SYFM_HUMAN Phenylalanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=FARS2 PE=1 SV=1
10	AFDB:O16129	0.478	0.642	2.225E-20	453	0.115	0.159	O16129.pdb.gz	SYFM_DROME Probable phenylalanine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=PheRS-m PE=2 SV=3
11	AFDB:C6KSN5	0.449	0.620	7.525E-20	443	0.130	0.183	C6KSN5.pdb.gz	C6KSN5_PLAF7 Phenylalanyl-tRNA synthetase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0603700 PE=3 SV=1
12	PDB:7db7B	0.196	0.153	2.576E-9	836	0.082	0.061	7db7B.pdb.gz	Re-discovery of PF-3845 as a new chemical scaffold inhibiting phenylalanyl-tRNA synthetase in Mycobacterium tuberculosis .
13	PDB:3pcoB	0.219	0.176	3.398E-9	795	0.072	0.057	3pcoB.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
14	PDB:2du4A	0.260	0.337	2.496E-8	466	0.067	0.090	2du4A.pdb.gz	Structural insights into the first step of RNA-dependent cysteine biosynthesis in archaea.
15	PDB:3tehA	0.273	0.584	2.788E-8	266	0.067	0.158	3tehA.pdb.gz	Bacterial and Eukaryotic Phenylalanyl-tRNA Synthetases Catalyze Misaminoacylation of tRNA(Phe) with 3,4-Dihydroxy-L-Phenylalanine.
16	PDB:2du3A	0.282	0.324	2.048E-7	534	0.072	0.084	2du3A.pdb.gz	Structural insights into the first step of RNA-dependent cysteine biosynthesis in archaea.
17	PDB:3l4gC	0.291	0.350	2.048E-7	508	0.062	0.077	3l4gC.pdb.gz	Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns.
18	PDB:5x6cA	0.276	0.316	2.288E-7	539	0.075	0.087	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
19	PDB:7k98A	0.279	0.481	4.207E-7	343	0.069	0.125	7k98A.pdb.gz	Mycobacterium tuberculosis Phe-tRNA synthetase: structural insights into tRNA recognition and aminoacylation.
20	PDB:1atiA	0.237	0.321	4.967E-7	437	0.056	0.080	1atiA.pdb.gz	Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRP7	0.0	1291	624	1.000	1.000	FDXA1_HUMAN Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FDXACB1 PE=1 SV=3
2	B4DYW0	6.89e-161	484	844	0.369	0.273	B4DYW0_HUMAN Mannosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
3	O74952	1.06e-20	97.4	429	0.072	0.105	SYFM_SCHPO Phenylalanine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mfs1 PE=3 SV=1
4	Q94K73	9.91e-20	94.4	429	0.077	0.112	SYFM_ARATH Phenylalanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g58140 PE=1 SV=1
5	C6KSN5	5.96e-19	92.0	443	0.072	0.102	C6KSN5_PLAF7 Phenylalanyl-tRNA synthetase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0603700 PE=3 SV=1
6	P08425	1.63e-18	90.9	469	0.072	0.096	SYFM_YEAST Phenylalanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSF1 PE=1 SV=3
7	Q99M01	7.89e-18	89.0	451	0.074	0.102	SYFM_MOUSE Phenylalanine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Fars2 PE=1 SV=1
8	O95363	2.97e-16	84.0	451	0.072	0.100	SYFM_HUMAN Phenylalanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=FARS2 PE=1 SV=1
9	O16129	3.00e-16	84.0	453	0.074	0.102	SYFM_DROME Probable phenylalanine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=PheRS-m PE=2 SV=3
10	Q6AYQ3	1.47e-14	79.0	472	0.077	0.102	SYFM_RAT Phenylalanine--tRNA ligase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fars2 PE=2 SV=1
11	O94480	6.98e-08	56.6	282	0.062	0.138	BMT5_SCHPO 25S rRNA (uridine-N(3))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bmt5 PE=3 SV=1
12	P40493	4.97e-05	48.1	336	0.082	0.152	BMT5_YEAST 25S rRNA (uridine(2634)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BMT5 PE=1 SV=1
13	O74439	0.30	36.2	300	0.035	0.073	YJE9_SCHPO Uncharacterized mitochondrial carrier C1682.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1682.09c PE=3 SV=1
14	P32792	1.7	33.9	385	0.029	0.047	YHH7_YEAST UPF0744 protein YSC83 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSC83 PE=1 SV=1
15	Q9JK30	2.0	33.9	715	0.034	0.029	ORC3_MOUSE Origin recognition complex subunit 3 OS=Mus musculus OX=10090 GN=Orc3 PE=1 SV=1
16	Q38C46	2.4	33.9	1405	0.030	0.014	Q38C46_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5860 PE=4 SV=1
17	P53278	7.9	32.0	816	0.035	0.027	YG3A_YEAST Uncharacterized protein YGR130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR130C PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10354 BMT5-like	2.4e-34	130.5	rRNA (uridine-N3-)-methyltransferase BTM5-like
2	PF03147 FDX-ACB	7.9e-13	60.0	Ferredoxin-fold anticodon binding domain
3	PF02390 Methyltransf_4	3e+02	12.3	Putative methyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260257

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331901	0.945	Elongation factor 1-gamma
2	9606.ENSP00000449328	0.797	60S acidic ribosomal protein P0
3	9606.ENSP00000429374	0.794	Ribosomal protein S20
4	9606.ENSP00000375730	0.792	60S ribosomal protein L13a
5	9606.ENSP00000393241	0.791	40S ribosomal protein S18
6	9606.ENSP00000281828	0.788	phenylalanyl-tRNA synthetase beta subunit
7	9606.ENSP00000367498	0.788	Leucine-rich repeat-containing protein 47
8	9606.ENSP00000437256	0.786	Endoribonuclease Dicer
9	9606.ENSP00000362576	0.782	Tyrosine--tRNA ligase, cytoplasmic
10	9606.ENSP00000311430	0.762	L ribosomal proteins
11	9606.ENSP00000385958	0.761	Ribosomal protein S14
12	9606.ENSP00000364815	0.759	Valine--tRNA ligase
13	9606.ENSP00000379339	0.749	Ribosomal protein S29
14	9606.ENSP00000278572	0.717	40S ribosomal protein S3
15	9606.ENSP00000307889	0.717	Ribosomal protein L13
16	9606.ENSP00000364320	0.717	mRNA turnover protein 4 homolog
17	9606.ENSP00000355890	0.716	Bifunctional glutamate/proline--tRNA ligase
18	9606.ENSP00000270625	0.715	Ribosomal protein S11
19	9606.ENSP00000420311	0.709	Ribosomal protein L23
20	9606.ENSP00000251453	0.695	Ribosomal protein S16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.597	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0010467	0.993	gene expression
GO:0034660	0.986	ncRNA metabolic process
GO:1901564	0.971	organonitrogen compound metabolic process
GO:0044260	0.966	cellular macromolecule metabolic process
GO:0044271	0.966	cellular nitrogen compound biosynthetic process
GO:0006399	0.952	tRNA metabolic process
GO:0043038	0.949	amino acid activation
GO:1901576	0.946	organic substance biosynthetic process
GO:0043603	0.890	amide metabolic process
GO:0043043	0.867	peptide biosynthetic process
GO:0019538	0.866	protein metabolic process
GO:0006412	0.858	translation
GO:0043039	0.566	tRNA aminoacylation
GO:0006418	0.486	tRNA aminoacylation for protein translation
GO:0034470	0.417	ncRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0031981	0.982	nuclear lumen
GO:0005739	0.978	mitochondrion
GO:0032991	0.954	protein-containing complex
GO:0043232	0.944	intracellular non-membrane-bounded organelle
GO:0005829	0.940	cytosol
GO:0005654	0.854	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]