StarFunc result for job id Q9BRP8

User Input

>input (204 residues)
MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELP
PGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEE
TAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPS
KEQLEKLARRRALEEELEDLELGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRP8	1.000	1.000	1.136E-31	204	1.000	1.000	Q9BRP8.pdb.gz	PYM1_HUMAN Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1
2	AFDB:Q14149	0.225	0.062	4.214E-2	939	0.191	0.042	Q14149.pdb.gz	MORC3_HUMAN MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3
3	AFDB:Q57Y14	0.208	0.088	8.647E-2	539	0.162	0.061	Q57Y14.pdb.gz	Q57Y14_TRYB2 Ribosomal protein L7Ae/L30e/S12e/Gadd45 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.440 PE=4 SV=1
4	AFDB:F7BJB9	0.215	0.059	7.975E-1	942	0.157	0.034	F7BJB9.pdb.gz	MORC3_MOUSE MORC family CW-type zinc finger protein 3 OS=Mus musculus OX=10090 GN=Morc3 PE=1 SV=1
5	AFDB:Q9US03	0.151	0.052	8.513E-1	817	0.157	0.039	Q9US03.pdb.gz	KLP2_SCHPO Kinesin-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp2 PE=3 SV=1
6	AFDB:A8DYM0	0.158	0.042	9.088E-1	1152	0.172	0.030	A8DYM0.pdb.gz	A8DYM0_DROME Liprin-gamma, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-gamma PE=4 SV=1
7	PDB:6hivDH	0.113	0.054	1.101	564	0.108	0.039	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
8	PDB:1serB	0.148	0.089	1.175	421	0.078	0.038	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
9	AFDB:Q9S7T1	0.171	0.099	1.180	461	0.157	0.069	Q9S7T1.pdb.gz	GTE3_ARATH Transcription factor GTE3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GTE3 PE=1 SV=1
10	AFDB:Q9FXG8	0.232	0.100	1.260	538	0.152	0.058	Q9FXG8.pdb.gz	BLH10_ARATH BEL1-like homeodomain protein 10 OS=Arabidopsis thaliana OX=3702 GN=BLH10 PE=1 SV=1
11	AFDB:Q9SIW1	0.209	0.103	1.260	482	0.157	0.066	Q9SIW1.pdb.gz	BLH7_ARATH BEL1-like homeodomain protein 7 OS=Arabidopsis thaliana OX=3702 GN=BLH7 PE=1 SV=1
12	PDB:7q83D	0.154	0.200	1.526	156	0.078	0.103	7q83D.pdb.gz
13	AFDB:Q0E342	0.142	0.083	1.533	355	0.176	0.101	Q0E342.pdb.gz	TGAL9_ORYSJ Transcription factor TGAL9 OS=Oryza sativa subsp. japonica OX=39947 GN=TGAL9 PE=1 SV=2
14	PDB:6o9lT	0.108	0.095	2.575	237	0.074	0.063	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:6ta5D	0.220	0.137	2.748	345	0.054	0.032	6ta5D.pdb.gz
16	PDB:7ajtCL	0.185	0.061	2.748	781	0.093	0.024	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:5ee3B	0.230	0.133	3.132	364	0.049	0.027	5ee3B.pdb.gz	ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
18	PDB:5ng5A	0.248	0.157	3.132	340	0.049	0.029	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
19	PDB:5oqj1	0.226	0.101	3.132	491	0.059	0.024	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
20	PDB:2p01A	0.204	0.141	3.569	323	0.123	0.077	2p01A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRP8	8.44e-143	398	204	1.000	1.000	PYM1_HUMAN Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1
2	P82804	2.57e-25	99.8	207	0.353	0.348	PYM_DROME Partner of Y14 and mago OS=Drosophila melanogaster OX=7227 GN=Pym PE=1 SV=1
3	Q9LPZ4	2.40e-10	59.7	204	0.309	0.309	PYM1_ARATH Partner of Y14 and mago OS=Arabidopsis thaliana OX=3702 GN=PYM PE=1 SV=1
4	Q8I5V8	6.55e-05	43.9	167	0.127	0.156	Q8I5V8_PLAF7 Mago-binding protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1209000 PE=4 SV=1
5	P53235	0.14	35.0	642	0.201	0.064	EIF2A_YEAST Eukaryotic translation initiation factor 2A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR054W PE=1 SV=1
6	Q19052	0.27	34.3	570	0.113	0.040	EIF2A_CAEEL Eukaryotic translation initiation factor 2A OS=Caenorhabditis elegans OX=6239 GN=eif-2A PE=3 SV=2
7	A0A499FIS5	1.7	32.0	453	0.108	0.049	A0A499FIS5_HUMAN MAPK interacting serine/threonine kinase 1 OS=Homo sapiens OX=9606 GN=MKNK1 PE=1 SV=1
8	Q9BUB5	1.8	31.6	465	0.108	0.047	MKNK1_HUMAN MAP kinase-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MKNK1 PE=1 SV=1
9	A2AKX3	3.0	31.2	2646	0.118	0.009	SETX_MOUSE Probable helicase senataxin OS=Mus musculus OX=10090 GN=Setx PE=1 SV=1
10	A1A5D2	3.4	30.8	748	0.108	0.029	A1A5D2_HUMAN SNX26 protein OS=Homo sapiens OX=9606 GN=SNX26 PE=1 SV=1
11	Q9USW8	4.0	30.0	196	0.088	0.092	YHY1_SCHPO Uncharacterized protein C19C7.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19C7.01 PE=4 SV=2
12	Q8CFA1	4.5	30.4	622	0.069	0.023	IRAK2_MOUSE Interleukin-1 receptor-associated kinase-like 2 OS=Mus musculus OX=10090 GN=Irak2 PE=2 SV=2
13	Q6IMN6	6.3	30.0	1127	0.108	0.020	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
14	Q12701	7.3	30.0	592	0.074	0.025	KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ksg1 PE=1 SV=2
15	Q0GNC1	8.0	30.0	1273	0.152	0.024	INF2_MOUSE Inverted formin-2 OS=Mus musculus OX=10090 GN=Inf2 PE=1 SV=1
16	Q07442	8.1	29.6	638	0.088	0.028	BDF2_YEAST Bromodomain-containing factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BDF2 PE=1 SV=1
17	G4S034	9.5	29.6	2427	0.147	0.012	G4S034_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
18	Q21408	9.8	29.6	2432	0.147	0.012	Q21408_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13476 AAA_23	1.2e+02	14.6	AAA domain
2	PF09282 Mago-bind	1.2e-09	49.2	Mago binding
3	PF07862 Nif11	3.9e+02	12.8	Nif11 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386156

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360525	0.999	Protein mago nashi homolog
2	9606.ENSP00000463058	0.999	RNA-binding protein 8A
3	9606.ENSP00000319240	0.997	Protein mago nashi homolog 2
4	9606.ENSP00000276201	0.984	Regulator of nonsense transcripts 3B
5	9606.ENSP00000269349	0.977	Eukaryotic initiation factor 4A-III
6	9606.ENSP00000264645	0.974	Protein CASC3
7	9606.ENSP00000470142	0.950	Regulator of nonsense transcripts 1
8	9606.ENSP00000348708	0.947	Regulator of nonsense transcripts 2
9	9606.ENSP00000364448	0.854	Regulator of nonsense transcripts 3A
10	9606.ENSP00000379267	0.789	Elongator complex protein 4
11	9606.ENSP00000343635	0.785	TLD domain-containing protein 1
12	9606.ENSP00000358059	0.699	Reticulon-4-interacting protein 1, mitochondrial
13	9606.ENSP00000364289	0.558	Nuclear cap-binding protein subunit 1
14	9606.ENSP00000430823	0.534	Zinc finger protein 706
15	9606.ENSP00000379475	0.502	Spliceosome RNA helicase DDX39B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043022	1.000	ribosome binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0000956	0.986	nuclear-transcribed mRNA catabolic process
GO:0000184	0.982	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0045727	0.978	positive regulation of translation
GO:0071840	0.932	cellular component organization or biogenesis
GO:0016043	0.908	cellular component organization
GO:0022411	0.901	cellular component disassembly
GO:0043933	0.770	protein-containing complex organization
GO:0032984	0.683	protein-containing complex disassembly
GO:0019219	0.321	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0035145	0.998	exon-exon junction complex
GO:0030054	0.984	cell junction
GO:0012505	0.333	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]