StarFunc result for job id Q9BRQ0

User Input

>input (406 residues)
MAASAPPPPDKLEGGGGPAPPPAPPSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTE
FAPPPTPMVDHLVASNPFEDDFGAPKVGVAAPPFLGSPVPFGGFRVQGGMAGQVPPGYST
GGGGGPQPLRRQPPPFPPNPMGPAFNMPPQGPGYPPPGNMNFPSQPFNQPLGQNFSPPSG
QMMPGPVGGFGPMISPTMGQPPRAELGPPSLSQRFAQPGAPFGPSPLQRPGQGLPSLPPN
TSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSPAAAVNGNQPSFPPNSSGRGG
GTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVNDDQDAILCEASCQKWFHRECTG
MTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMGQLVAANDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRQ0	0.999	0.999	6.888E-58	406	1.000	1.000	Q9BRQ0.pdb.gz	PYGO2_HUMAN Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2
2	AFDB:Q9D0P5	0.225	0.221	2.396E-19	417	0.382	0.372	Q9D0P5.pdb.gz	PYGO1_MOUSE Pygopus homolog 1 OS=Mus musculus OX=10090 GN=Pygo1 PE=1 SV=1
3	AFDB:Q9Y3Y4	0.184	0.178	5.103E-19	419	0.377	0.365	Q9Y3Y4.pdb.gz	PYGO1_HUMAN Pygopus homolog 1 OS=Homo sapiens OX=9606 GN=PYGO1 PE=1 SV=2
4	AFDB:Q1L8T6	0.229	0.174	7.199E-17	571	0.525	0.373	Q1L8T6.pdb.gz	Q1L8T6_DANRE Pygopus homolog 2 OS=Danio rerio OX=7955 GN=wu:fc46c10 PE=1 SV=1
5	AFDB:B0JZI5	0.086	0.068	9.186E-4	561	0.387	0.280	B0JZI5.pdb.gz
6	PDB:5z8lA	0.112	0.214	2.757E-2	204	0.039	0.078	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
7	AFDB:Q9U489	0.081	0.035	1.593E-1	1147	0.200	0.071	Q9U489.pdb.gz	LIN41_CAEEL Protein lin-41 OS=Caenorhabditis elegans OX=6239 GN=lin-41 PE=1 SV=1
8	PDB:1b8tA	0.099	0.185	1.764E-1	192	0.049	0.104	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
9	AFDB:P97433	0.084	0.026	1.958E-1	1693	0.153	0.037	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
10	PDB:7kzpL	0.074	0.080	4.311E-1	370	0.030	0.032	7kzpL.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
11	AFDB:A2A8R0	0.098	0.033	5.125E-1	1397	0.163	0.047	A2A8R0.pdb.gz	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
12	AFDB:Q8N1W1	0.109	0.030	5.125E-1	1705	0.185	0.044	Q8N1W1.pdb.gz	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
13	AFDB:Q9UFB7	0.070	0.043	5.490E-1	747	0.155	0.084	Q9UFB7.pdb.gz	ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens OX=9606 GN=ZBTB47 PE=1 SV=3
14	PDB:6ip52Q	0.076	0.193	1.054	124	0.025	0.081	6ip52Q.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.
15	PDB:6ft6u	0.079	0.168	1.295	150	0.025	0.067	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
16	PDB:5ndgn4	0.077	0.190	1.486	118	0.020	0.068	5ndgn4.pdb.gz	Aminoglycoside interactions and impacts on the eukaryotic ribosome.
17	PDB:7ls2Q2	0.075	0.213	1.591	110	0.022	0.082	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
18	PDB:7uhyD	0.079	0.101	1.956	288	0.042	0.059	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:8a3tU	0.088	0.243	2.095	114	0.025	0.088	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:2pv0B	0.103	0.120	2.244	347	0.032	0.037	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V113	0.0	684	368	0.877	0.967	Q3V113_MOUSE Pygopus 2 OS=Mus musculus OX=10090 GN=Pygo2 PE=1 SV=1
2	Q80V76	0.0	747	405	0.966	0.968	Q80V76_MOUSE Pygopus 2 OS=Mus musculus OX=10090 GN=Pygo2 PE=1 SV=1
3	Q9BRQ0	0.0	781	406	1.000	1.000	PYGO2_HUMAN Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2
4	Q9D0P5	1.44e-63	211	417	0.374	0.365	PYGO1_MOUSE Pygopus homolog 1 OS=Mus musculus OX=10090 GN=Pygo1 PE=1 SV=1
5	Q9Y3Y4	5.13e-63	210	419	0.367	0.356	PYGO1_HUMAN Pygopus homolog 1 OS=Homo sapiens OX=9606 GN=PYGO1 PE=1 SV=2
6	A8WG61	9.80e-45	160	337	0.296	0.356	A8WG61_DANRE Pygopus homolog 1 OS=Danio rerio OX=7955 GN=pygo1 PE=2 SV=1
7	Q1L8T6	3.05e-43	160	571	0.158	0.112	Q1L8T6_DANRE Pygopus homolog 2 OS=Danio rerio OX=7955 GN=wu:fc46c10 PE=1 SV=1
8	Q9V9W8	2.50e-19	92.4	815	0.076	0.038	PYGO_DROME Protein pygopus OS=Drosophila melanogaster OX=7227 GN=pygo PE=1 SV=1
9	Q9BTC0	0.47	35.4	2240	0.032	0.006	DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5
10	Q8C9B9	0.54	35.0	2256	0.032	0.006	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
11	Q9UMN6	0.66	35.0	2715	0.032	0.005	KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	0.00068	30.8	PHD-finger
2	PF13831 PHD_2	1.4e+02	13.4	PHD-finger
3	PF14446 Prok-RING_1	2.3	19.5	Prokaryotic RING finger family 1
4	PF13639 zf-RING_2	3.4e+02	13.0	Ring finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234739	0.996	B-cell CLL/lymphoma 9 protein
2	9606.ENSP00000344456	0.977	Catenin beta-1
3	9606.ENSP00000335320	0.967	B-cell CLL/lymphoma 9-like protein
4	9606.ENSP00000392466	0.948	LIM domain-binding protein 1
5	9606.ENSP00000452871	0.925	Transducin-like enhancer protein 3
6	9606.ENSP00000365682	0.924	Transducin-like enhancer protein 1
7	9606.ENSP00000365720	0.922	Transducin-like enhancer protein 4
8	9606.ENSP00000355657	0.914	Histone H3.1t
9	9606.ENSP00000308405	0.903	Histone H2A.V
10	9606.ENSP00000358151	0.903	Histone H2B type 2-E
11	9606.ENSP00000434024	0.903	Histone H2AX
12	9606.ENSP00000332194	0.901	Histone H2A type 2-C
13	9606.ENSP00000274764	0.900	Histone H2B type 1-A
14	9606.ENSP00000289316	0.900	Histone H2B type 1-D
15	9606.ENSP00000296417	0.900	Histone H2A.Z
16	9606.ENSP00000328484	0.900	Histone H2A type 1-J
17	9606.ENSP00000341094	0.900	Histone H2A type 1-D
18	9606.ENSP00000349430	0.900	Histone H2B type 1-K
19	9606.ENSP00000366618	0.900	Histone H2B type 1-L
20	9606.ENSP00000367022	0.900	Histone H2A type 1-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042393	0.967	histone binding
GO:0003682	0.426	chromatin binding
GO:0098772	0.412	molecular function regulator activity
GO:0030234	0.364	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0080090	0.991	regulation of primary metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0009987	0.984	cellular process
GO:0050896	0.938	response to stimulus
GO:0071840	0.854	cellular component organization or biogenesis
GO:0051716	0.843	cellular response to stimulus
GO:0007154	0.840	cell communication
GO:0032502	0.836	developmental process
GO:0000003	0.834	reproduction
GO:0016043	0.834	cellular component organization
GO:0032501	0.830	multicellular organismal process
GO:0007165	0.829	signal transduction
GO:0048856	0.754	anatomical structure development
GO:0048518	0.744	positive regulation of biological process
GO:0010468	0.710	regulation of gene expression
GO:0042127	0.684	regulation of cell population proliferation
GO:0048513	0.565	animal organ development
GO:0009893	0.562	positive regulation of metabolic process
GO:0051246	0.553	regulation of protein metabolic process
GO:0065009	0.550	regulation of molecular function
GO:0019219	0.548	regulation of nucleobase-containing compound metabolic process
GO:0031399	0.540	regulation of protein modification process
GO:0006355	0.536	regulation of DNA-templated transcription
GO:0010604	0.533	positive regulation of macromolecule metabolic process
GO:0048522	0.520	positive regulation of cellular process
GO:0051173	0.509	positive regulation of nitrogen compound metabolic process
GO:0007166	0.504	cell surface receptor signaling pathway
GO:0060070	0.447	canonical Wnt signaling pathway
GO:0031060	0.411	regulation of histone methylation
GO:0060021	0.409	roof of mouth development
GO:0030879	0.407	mammary gland development
GO:0048519	0.405	negative regulation of biological process
GO:0048523	0.403	negative regulation of cellular process
GO:0044093	0.384	positive regulation of molecular function
GO:0007399	0.375	nervous system development
GO:0031325	0.375	positive regulation of cellular metabolic process
GO:0050678	0.363	regulation of epithelial cell proliferation
GO:0002088	0.359	lens development in camera-type eye
GO:0048589	0.355	developmental growth
GO:0030154	0.355	cell differentiation
GO:0051254	0.339	positive regulation of RNA metabolic process
GO:0022414	0.335	reproductive process
GO:0051099	0.330	positive regulation of binding
GO:0048468	0.313	cell development
GO:1903508	0.308	positive regulation of nucleic acid-templated transcription
GO:0007420	0.305	brain development
GO:0006357	0.303	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.887	nuclear lumen
GO:0005654	0.857	nucleoplasm
GO:0032991	0.795	protein-containing complex
GO:0005737	0.498	cytoplasm
GO:0090575	0.362	RNA polymerase II transcription regulator complex
GO:1990907	0.336	beta-catenin-TCF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]