StarFunc result for job id Q9BRQ6

User Input

>input (235 residues)
MGSTESSEGRRVSFGVDEEERVRVLQGVRLSENVVNRMKEPSSPPPAPTSSTFGLQDGNL
RAPHKESTLPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKASL
PTGEGSISHEEQKSVRLARELESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEA
ASKMESTIKPRRVEPVCSGLQAQILHCYRDRPHEVLLCSDLVKAYQRCVSAAHKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3QTA6	0.587	0.543	3.070E-32	256	0.996	0.914	J3QTA6.pdb.gz	J3QTA6_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 6 OS=Homo sapiens OX=9606 GN=CHCHD6 PE=1 SV=1
2	AFDB:C9JRZ6	0.316	0.319	2.599E-10	232	0.353	0.358	C9JRZ6.pdb.gz	C9JRZ6_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 3 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=2
3	AFDB:Q91VG6	0.316	0.383	4.584E-7	191	0.238	0.293	Q91VG6.pdb.gz	Q91VG6_MOUSE Chchd3 protein (Fragment) OS=Mus musculus OX=10090 GN=Chchd3 PE=2 SV=1
4	AFDB:P36188	0.151	0.135	2.258E-2	269	0.179	0.156	P36188.pdb.gz	TNNI_DROME Troponin I OS=Drosophila melanogaster OX=7227 GN=wupA PE=2 SV=3
5	AFDB:Q61187	0.210	0.130	2.769E-2	391	0.179	0.107	Q61187.pdb.gz	TS101_MOUSE Tumor susceptibility gene 101 protein OS=Mus musculus OX=10090 GN=Tsg101 PE=1 SV=2
6	AFDB:Q5SZL2	0.245	0.079	7.673E-2	805	0.234	0.068	Q5SZL2.pdb.gz	CE85L_HUMAN Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1
7	AFDB:Q57ZJ7	0.142	0.057	1.235E-1	785	0.204	0.061	Q57ZJ7.pdb.gz	Q57ZJ7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.780 PE=4 SV=1
8	AFDB:Q9VVA7	0.134	0.090	1.235E-1	408	0.170	0.098	Q9VVA7.pdb.gz	Q9VVA7_DROME Tumor suppressor protein 101 OS=Drosophila melanogaster OX=7227 GN=TSG101 PE=1 SV=2
9	AFDB:Q12315	0.182	0.094	1.321E-1	538	0.209	0.091	Q12315.pdb.gz	GLE1_YEAST mRNA export factor GLE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLE1 PE=1 SV=1
10	AFDB:Q96HY6	0.128	0.116	1.987E-1	314	0.174	0.131	Q96HY6.pdb.gz	DDRGK_HUMAN DDRGK domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DDRGK1 PE=1 SV=2
11	PDB:7pnw2	0.184	0.354	7.926E-1	117	0.030	0.060	7pnw2.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
12	PDB:7p2e2	0.184	0.354	1.113	117	0.026	0.051	7p2e2.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
13	PDB:7b93o	0.163	0.324	1.917	115	0.038	0.078	7b93o.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
14	PDB:7qsdo	0.166	0.310	1.917	122	0.038	0.074	7qsdo.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
15	PDB:1u96A	0.146	0.450	2.052	69	0.034	0.116	1u96A.pdb.gz	Yeast cox17 solution structure and Copper(I) binding.
16	PDB:1hp8A	0.158	0.490	2.197	68	0.021	0.074	1hp8A.pdb.gz
17	PDB:7qsoC	0.073	0.081	2.693	210	0.047	0.052	7qsoC.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
18	PDB:2w1tA	0.075	0.099	3.535	175	0.021	0.029	2w1tA.pdb.gz
19	PDB:7mbyR	0.074	0.064	3.783	283	0.009	0.007	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
20	PDB:7qooH	0.216	0.237	4.639	210	0.119	0.133	7qooH.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRQ6	1.86e-173	478	235	1.000	1.000	MIC25_HUMAN MICOS complex subunit MIC25 OS=Homo sapiens OX=9606 GN=CHCHD6 PE=1 SV=1
2	J3QTA6	2.30e-169	468	256	0.996	0.914	J3QTA6_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 6 OS=Homo sapiens OX=9606 GN=CHCHD6 PE=1 SV=1
3	H0Y922	1.81e-116	331	166	0.702	0.994	H0Y922_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 6 (Fragment) OS=Homo sapiens OX=9606 GN=CHCHD6 PE=1 SV=1
4	A4D1N4	2.28e-39	137	227	0.366	0.379	A4D1N4_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 3 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=4 SV=1
5	Q9NX63	2.28e-39	137	227	0.366	0.379	MIC19_HUMAN MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1
6	Q9CRB9	4.69e-39	136	227	0.366	0.379	MIC19_MOUSE MICOS complex subunit Mic19 OS=Mus musculus OX=10090 GN=Chchd3 PE=1 SV=1
7	C9JRZ6	3.92e-37	132	232	0.362	0.366	C9JRZ6_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 3 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=2
8	Q9D9P1	2.06e-24	97.4	175	0.289	0.389	Q9D9P1_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 3 OS=Mus musculus OX=10090 GN=Chchd3 PE=1 SV=1
9	Q91VG6	4.48e-24	97.1	191	0.238	0.293	Q91VG6_MOUSE Chchd3 protein (Fragment) OS=Mus musculus OX=10090 GN=Chchd3 PE=2 SV=1
10	Q9VA18	3.48e-05	45.8	223	0.106	0.112	Q9VA18_DROME Coiled-coil-helix-coiled-coil-helix domain containing 3 OS=Drosophila melanogaster OX=7227 GN=Chchd3 PE=1 SV=1
11	Q8IDX6	0.003	40.8	3130	0.140	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
12	B1AR69	0.21	35.0	1938	0.094	0.011	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
13	G0Y7D3	2.0	32.0	580	0.119	0.048	TPS3_LITCU Alpha-thujene synthase TPS3, chloroplastic OS=Litsea cubeba OX=155299 GN=TPS3 PE=1 SV=1
14	P29616	2.3	32.0	1102	0.111	0.024	MYSC_CHICK Myosin heavy chain, cardiac muscle isoform (Fragment) OS=Gallus gallus OX=9031 PE=1 SV=1
15	Q6IQX1	2.5	32.0	1935	0.081	0.010	Q6IQX1_DANRE Myosin, heavy polypeptide 2, fast muscle specific isoform X1 OS=Danio rerio OX=7955 GN=sb:cb38 PE=1 SV=1
16	Q6NV01	3.6	31.2	391	0.115	0.069	Q6NV01_DANRE Sprouty-related, EVH1 domain containing 1 OS=Danio rerio OX=7955 GN=zgc:85707 PE=2 SV=1
17	B8A568	4.9	30.8	1937	0.068	0.008	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
18	R4GDZ5	5.2	30.8	1938	0.094	0.011	R4GDZ5_DANRE Myosin, heavy chain 7B, cardiac muscle, beta a OS=Danio rerio OX=7955 GN=myh7b PE=1 SV=3
19	I6P4V6	6.7	30.4	475	0.098	0.048	I6P4V6_STEMA PolyMG-specific alginate lyase OS=Stenotrophomonas maltophilia OX=40324 GN=alyMG PE=4 SV=1
20	Q9UKX3	7.6	30.4	1938	0.072	0.009	MYH13_HUMAN Myosin-13 OS=Homo sapiens OX=9606 GN=MYH13 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06747 CHCH	4.5	18.8	CHCH domain
2	PF10370 DUF2437	2.4e+02	14.1	Domain of unknown function (DUF2437)
3	PF12710 HAD	2.9e+02	13.3	haloacid dehalogenase-like hydrolase
4	PF05300 MIC19_MIC25	4.6e-29	113.8	MICOS complex subunit MIC19/MIC25

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290913

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387262	0.995	MICOS complex subunit MIC60
2	9606.ENSP00000368528	0.990	MICOS complex subunit MIC26
3	9606.ENSP00000362268	0.989	MICOS complex subunit MIC27
4	9606.ENSP00000249442	0.980	Metaxin-2
5	9606.ENSP00000309561	0.980	MICOS complex subunit MIC13
6	9606.ENSP00000262570	0.979	MICOS complex subunit MIC19
7	9606.ENSP00000418428	0.976	Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial
8	9606.ENSP00000345445	0.958	Sorting and assembly machinery component 50 homolog
9	9606.ENSP00000325562	0.940	MICOS complex subunit MIC10
10	9606.ENSP00000366800	0.921	DnaJ homolog subfamily C member 11
11	9606.ENSP00000357360	0.916	Metaxin-1
12	9606.ENSP00000378812	0.896	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
13	9606.ENSP00000362873	0.892	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
14	9606.ENSP00000423600	0.858	Metaxin-3
15	9606.ENSP00000410339	0.841	Mitochondrial import receptor subunit TOM40 homolog
16	9606.ENSP00000284320	0.831	Mitochondrial import receptor subunit TOM70
17	9606.ENSP00000268668	0.796	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
18	9606.ENSP00000420617	0.792	Mitofusin-1
19	9606.ENSP00000216034	0.790	Mitochondrial import receptor subunit TOM22 homolog
20	9606.ENSP00000438204	0.771	Mitochondrial import receptor subunit TOM5 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.321	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007005	0.997	mitochondrion organization
GO:0007007	0.991	inner mitochondrial membrane organization
GO:0006974	0.963	cellular response to DNA damage stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.998	mitochondrial membrane
GO:0098798	0.997	mitochondrial protein-containing complex
GO:0005829	0.993	cytosol
GO:0098796	0.980	membrane protein complex
GO:0005743	0.975	mitochondrial inner membrane
GO:0098800	0.973	inner mitochondrial membrane protein complex
GO:0031968	0.965	organelle outer membrane
GO:0005742	0.957	mitochondrial outer membrane translocase complex
GO:0001401	0.893	SAM complex
GO:0061617	0.441	MICOS complex
GO:0070013	0.375	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]