StarFunc result for job id Q9BRQ8

User Input

>input (373 residues)
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETG
FAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFN
EVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALA
DKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVI
LCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGL
HANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLF
VSTSWKTMRQSPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BUE4	0.995	0.995	6.138E-74	373	0.903	0.903	Q8BUE4.pdb.gz	FSP1_MOUSE Ferroptosis suppressor protein 1 OS=Mus musculus OX=10090 GN=Aifm2 PE=1 SV=1
2	AFDB:Q54NS9	0.891	0.817	1.618E-36	408	0.303	0.277	Q54NS9.pdb.gz	AIFA_DICDI Apoptosis-inducing factor homolog A OS=Dictyostelium discoideum OX=44689 GN=aifA PE=3 SV=1
3	AFDB:Q9C574	0.885	0.904	1.077E-35	365	0.295	0.301	Q9C574.pdb.gz	Q9C574_ARATH FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g22140 PE=1 SV=1
4	AFDB:Q9LXP4	0.866	0.879	7.594E-35	367	0.306	0.311	Q9LXP4.pdb.gz	Q9LXP4_ARATH At3g44190 OS=Arabidopsis thaliana OX=3702 GN=F26G5_140 PE=1 SV=1
5	AFDB:A0A1D8PI22	0.846	0.859	7.067E-32	367	0.249	0.253	A0A1D8PI22.pdb.gz	A0A1D8PI22_CANAL FAD/NAD(P)-binding domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C208100WA PE=4 SV=1
6	AFDB:Q7S4Y9	0.849	0.737	7.341E-28	433	0.268	0.231	Q7S4Y9.pdb.gz	Q7S4Y9_NEUCR Oxidoreductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU06061 PE=4 SV=1
7	AFDB:P00393	0.765	0.665	4.591E-26	434	0.247	0.212	P00393.pdb.gz	NDH_ECOLI Type II NADH:quinone oxidoreductase OS=Escherichia coli (strain K12) OX=83333 GN=ndh PE=1 SV=2
8	AFDB:P52923	0.824	0.814	8.637E-26	378	0.201	0.198	P52923.pdb.gz	AIF1_YEAST Apoptosis-inducing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIF1 PE=1 SV=1
9	AFDB:P95160	0.739	0.606	4.293E-24	463	0.225	0.181	P95160.pdb.gz	NDH_MYCTU Type II NADH:quinone oxidoreductase Ndh OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ndh PE=1 SV=1
10	AFDB:P95200	0.729	0.589	1.016E-23	470	0.228	0.181	P95200.pdb.gz	NDHA_MYCTU Type II NADH:quinone oxidoreductase NdhA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ndhA PE=1 SV=1
11	PDB:2v3aA	0.660	0.647	1.929E-20	381	0.190	0.186	2v3aA.pdb.gz	Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
12	PDB:3hyvA	0.735	0.648	7.231E-20	429	0.185	0.161	3hyvA.pdb.gz	The structure of Aquifex aeolicus sulfide:quinone oxidoreductase, a basis to understand sulfide detoxification and respiration
13	PDB:4g6hA	0.713	0.575	1.284E-19	472	0.212	0.167	4g6hA.pdb.gz	Structural insight into the type-II mitochondrial NADH dehydrogenases.
14	PDB:5yjyB	0.710	0.582	2.416E-19	465	0.204	0.163	5yjyB.pdb.gz	Ubiquinone binding site of yeast NADH dehydrogenase revealed by structures binding novel competitive- and mixed-type inhibitors
15	PDB:6mo6B	0.725	0.660	5.074E-18	414	0.147	0.133	6mo6B.pdb.gz	X-Ray Structure of Human Sulfide:Quinone Oxidoreductase: Insights into the Mechanism of Mitochondrial Hydrogen Sulfide Oxidation.
16	PDB:1q1wA	0.685	0.610	2.259E-17	422	0.206	0.182	1q1wA.pdb.gz	Crystal structure of putidaredoxin reductase from Pseudomonas putida, the final structural component of the cytochrome P450cam monooxygenase.
17	PDB:5jciA	0.697	0.607	1.065E-16	432	0.164	0.141	5jciA.pdb.gz	Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
18	PDB:6btlA	0.642	0.499	1.195E-16	492	0.196	0.148	6btlA.pdb.gz	Biological Evaluation and X-ray Co-crystal Structures of Cyclohexylpyrrolidine Ligands for Trypanothione Reductase, an Enzyme from the Redox Metabolism of Trypanosoma.
19	PDB:5jwaA	0.699	0.542	2.996E-16	495	0.177	0.133	5jwaA.pdb.gz	Target Elucidation by Cocrystal Structures of NADH-Ubiquinone Oxidoreductase of Plasmodium falciparum (PfNDH2) with Small Molecule To Eliminate Drug-Resistant Malaria
20	PDB:1xdiA	0.611	0.505	3.993E-16	459	0.164	0.133	1xdiA.pdb.gz	Characterization of a New Member of the Flavoprotein Disulfide Reductase Family of Enzymes from Mycobacterium tuberculosis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BUE4	0.0	642	373	0.903	0.903	FSP1_MOUSE Ferroptosis suppressor protein 1 OS=Mus musculus OX=10090 GN=Aifm2 PE=1 SV=1
2	Q9BRQ8	0.0	763	373	1.000	1.000	FSP1_HUMAN Ferroptosis suppressor protein 1 OS=Homo sapiens OX=9606 GN=AIFM2 PE=1 SV=1
3	Q54NS9	3.15e-50	175	408	0.308	0.282	AIFA_DICDI Apoptosis-inducing factor homolog A OS=Dictyostelium discoideum OX=44689 GN=aifA PE=3 SV=1
4	Q9C574	5.42e-48	168	365	0.319	0.326	Q9C574_ARATH FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g22140 PE=1 SV=1
5	Q9LXP4	1.95e-46	164	367	0.316	0.322	Q9LXP4_ARATH At3g44190 OS=Arabidopsis thaliana OX=3702 GN=F26G5_140 PE=1 SV=1
6	A0A1D8PI22	3.19e-26	110	367	0.257	0.262	A0A1D8PI22_CANAL FAD/NAD(P)-binding domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C208100WA PE=4 SV=1
7	P37596	1.19e-15	79.7	377	0.209	0.207	NORW_ECOLI Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) OX=83333 GN=norW PE=1 SV=3
8	Q7S4Y9	1.57e-14	76.6	433	0.228	0.196	Q7S4Y9_NEUCR Oxidoreductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU06061 PE=4 SV=1
9	Q8GXR9	6.42e-14	75.1	519	0.263	0.189	NDC1_ARATH Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDC1 PE=1 SV=2
10	Q1JPL4	1.66e-10	64.7	571	0.255	0.166	NDB1_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NDB1 PE=1 SV=1
11	P16640	5.30e-10	62.8	422	0.217	0.192	CAMA_PSEPU Putidaredoxin reductase CamA OS=Pseudomonas putida OX=303 GN=camA PE=1 SV=1
12	Q10499	9.90e-10	62.4	611	0.206	0.126	AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aif1 PE=3 SV=3
13	P95160	3.49e-09	60.5	463	0.260	0.210	NDH_MYCTU Type II NADH:quinone oxidoreductase Ndh OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ndh PE=1 SV=1
14	Q9LK94	5.68e-09	59.7	488	0.142	0.109	MDAR4_ARATH Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=MDAR4 PE=1 SV=1
15	Q9ST62	6.21e-09	59.7	577	0.236	0.153	NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum OX=4113 GN=NDB1 PE=1 SV=1
16	A7LKG5	2.65e-08	57.8	440	0.201	0.170	A7LKG5_ALKPO NADH dehydrogenase, NDH-2B OS=Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) OX=398511 GN=ndhB PE=4 SV=1
17	Q9HTK9	7.39e-08	56.2	384	0.201	0.195	RURE_PSEAE Rubredoxin-NAD(+) reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=alkT PE=1 SV=1
18	P00393	2.47e-07	54.7	434	0.268	0.230	NDH_ECOLI Type II NADH:quinone oxidoreductase OS=Escherichia coli (strain K12) OX=83333 GN=ndh PE=1 SV=2
19	Q57UR1	3.21e-07	54.3	513	0.126	0.092	Q57UR1_TRYB2 FAD/NAD(P)-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.130 PE=4 SV=1
20	P95200	4.91e-07	53.9	470	0.257	0.204	NDHA_MYCTU Type II NADH:quinone oxidoreductase NdhA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ndhA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01262 AlaDh_PNT_C	1.1	20.1	Alanine dehydrogenase/PNT, C-terminal domain
2	PF01266 DAO	0.00016	33.0	FAD dependent oxidoreductase
3	PF00890 FAD_binding_2	0.33	21.6	FAD binding domain
4	PF12831 FAD_oxidored	50	14.7	FAD dependent oxidoreductase
5	PF01134 GIDA	0.058	24.1	Glucose inhibited division protein A
6	PF03486 HI0933_like	1.6	19.0	HI0933-like protein
7	PF05834 Lycopene_cycl	1.1	19.9	Lycopene cyclase protein
8	PF13434 Lys_Orn_oxgnase	0.0039	28.0	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
9	PF13450 NAD_binding_8	0.14	23.7	NAD(P)-binding Rossmann-like domain
10	PF13454 NAD_binding_9	0.042	25.4	FAD-NAD(P)-binding
11	PF07848 PaaX	3.4e+02	12.9	PaaX-like protein
12	PF00070 Pyr_redox	5.4e-11	54.2	Pyridine nucleotide-disulphide oxidoreductase
13	PF07992 Pyr_redox_2	3.4e-36	136.6	Pyridine nucleotide-disulphide oxidoreductase
14	PF13738 Pyr_redox_3	6.7e-09	47.0	Pyridine nucleotide-disulphide oxidoreductase
15	PF01946 Thi4	0.17	22.7	Thi4 family
16	PF02254 TrkA_N	25	16.5	TrkA-N domain
17	PF04820 Trp_halogenase	0.48	20.9	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478931

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.939	Cellular tumor antigen p53
2	9606.ENSP00000389813	0.876	Acyl-CoA dehydrogenase family member 10
3	9606.ENSP00000323065	0.764	Growth arrest and DNA damage-inducible proteins-interacting protein 1
4	9606.ENSP00000287078	0.650	Peroxisomal leader peptide-processing protease
5	9606.ENSP00000417229	0.626	Eukaryotic translation initiation factor 2A
6	9606.ENSP00000450353	0.594	Uncharacterized protein
7	9606.ENSP00000348775	0.592	Peroxisomal acyl-coenzyme A oxidase 3
8	9606.ENSP00000407761	0.592	Acyl-coenzyme A oxidase-like protein
9	9606.ENSP00000377668	0.582	Sulfite oxidase, mitochondrial
10	9606.ENSP00000369618	0.566	FAST kinase domain-containing protein 5, mitochondrial
11	9606.ENSP00000361725	0.558	Endonuclease G, mitochondrial
12	9606.ENSP00000287295	0.557	Apoptosis-inducing factor 1, mitochondrial
13	9606.ENSP00000426638	0.552	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
14	9606.ENSP00000382120	0.536	Apoptosis-inducing factor 3
15	9606.ENSP00000264990	0.535	Acyl-CoA dehydrogenase family member 11
16	9606.ENSP00000371607	0.519	Mitochondrial intermediate peptidase
17	9606.ENSP00000301454	0.505	Calcium-binding mitochondrial carrier protein SCaMC-3
18	9606.ENSP00000393559	0.502	Phosphofurin acidic cluster sorting protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016491	0.996	oxidoreductase activity
GO:1901363	0.862	heterocyclic compound binding
GO:0097159	0.838	organic cyclic compound binding
GO:0043167	0.761	ion binding
GO:0000166	0.485	nucleotide binding
GO:0050660	0.474	flavin adenine dinucleotide binding
GO:0016651	0.411	oxidoreductase activity, acting on NAD(P)H

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0065007	0.981	biological regulation
GO:0008152	0.974	metabolic process
GO:0050789	0.972	regulation of biological process
GO:0050794	0.960	regulation of cellular process
GO:0044237	0.891	cellular metabolic process
GO:0071704	0.881	organic substance metabolic process
GO:0071840	0.648	cellular component organization or biogenesis
GO:0016043	0.625	cellular component organization
GO:0007005	0.528	mitochondrion organization
GO:0048518	0.432	positive regulation of biological process
GO:0044281	0.430	small molecule metabolic process
GO:0048522	0.373	positive regulation of cellular process
GO:0048519	0.360	negative regulation of biological process
GO:0048523	0.351	negative regulation of cellular process
GO:0043067	0.301	regulation of programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005739	1.000	mitochondrion
GO:0031967	0.998	organelle envelope
GO:0031966	0.991	mitochondrial membrane
GO:0005634	0.978	nucleus
GO:0043233	0.937	organelle lumen
GO:0070013	0.928	intracellular organelle lumen
GO:0005886	0.859	plasma membrane
GO:0043232	0.831	intracellular non-membrane-bounded organelle
GO:0005829	0.817	cytosol
GO:0005576	0.778	extracellular region
GO:0098588	0.467	bounding membrane of organelle
GO:0005615	0.422	extracellular space
GO:0019866	0.307	organelle inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.996	Oxidoreductases.
EC:1.6.-.-	0.411	Acting on NADH or NADPH.

[back to server]