StarFunc result for job id Q9BRS2

User Input

>input (568 residues)
MDYRRLLMSRVVPGQFDDADSSDSENRDLKTVKEKDDILFEDLQDNVNENGEGEIEDEEE
EGYDDDDDDWDWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKI
NLDKLNVTDSVINKVTEKSRQKEADMYRIKDKADRATVEQVLDPRTRMILFKMLTRGIIT
EINGCISTGKEANVYHASTANGESRAIKIYKTSILVFKDRDKYVSGEFRFRHGYCKGNPR
KMVKTWAEKEMRNLIRLNTAEIPCPEPIMLRSHVLVMSFIGKDDMPAPLLKNVQLSESKA
RELYLQVIQYMRRMYQDARLVHADLSEFNMLYHGGGVYIIDVSQSVEHDHPHALEFLRKD
CANVNDFFMRHSVAVMTVRELFEFVTDPSITHENMDAYLSKAMEIASQRTKEERSSQDHV
DEEVFKRAYIPRTLNEVKNYERDMDIIMKLKEEDMAMNAQQDNILYQTVTGLKKDLSGVQ
KVPALLENQVEERTCSDSEDIGSSECSDTDSEEQGDHARPKKHTTDPDIDKKERKKMVKE
AQREKRKNKIPKHVKKRKEKTAKTKKGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRS2	1.000	1.000	3.927E-92	568	1.000	1.000	Q9BRS2.pdb.gz	RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2
2	PDB:6zxfz	0.539	0.814	2.163E-47	373	0.651	0.992	6zxfz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
3	AFDB:Q9VTL5	0.574	0.557	5.836E-47	585	0.477	0.463	Q9VTL5.pdb.gz	Q9VTL5_DROME Serine/threonine-protein kinase RIO1 OS=Drosophila melanogaster OX=7227 GN=RIOK1 PE=2 SV=1
4	AFDB:O42650	0.520	0.591	7.506E-38	497	0.371	0.425	O42650.pdb.gz	RIO1_SCHPO Serine/threonine-protein kinase rio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio1 PE=3 SV=2
5	AFDB:O44959	0.491	0.550	8.824E-38	506	0.364	0.409	O44959.pdb.gz	RIOK1_CAEEL Serine/threonine-protein kinase RIO1 OS=Caenorhabditis elegans OX=6239 GN=riok-1 PE=2 SV=5
6	PDB:6zxdz	0.448	0.857	8.913E-36	292	0.511	0.993	6zxdz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
7	AFDB:G5EAT2	0.517	0.526	3.702E-35	558	0.379	0.385	G5EAT2.pdb.gz	G5EAT2_EMENI Serine/threonine-protein kinase RIO1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06363 PE=3 SV=1
8	AFDB:Q12196	0.471	0.549	2.100E-30	484	0.312	0.366	Q12196.pdb.gz	RIO1_YEAST Serine/threonine-protein kinase RIO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIO1 PE=1 SV=1
9	AFDB:O14730	0.398	0.435	8.345E-28	519	0.234	0.256	O14730.pdb.gz	RIOK3_HUMAN Serine/threonine-protein kinase RIO3 OS=Homo sapiens OX=9606 GN=RIOK3 PE=1 SV=2
10	PDB:6g18v	0.284	0.482	9.467E-12	325	0.097	0.169	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.
11	PDB:6fail	0.289	0.556	3.033E-9	286	0.077	0.154	6fail.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
12	AFDB:Q9VJ90	0.220	0.191	3.908E-8	665	0.090	0.077	Q9VJ90.pdb.gz	Q9VJ90_DROME FI19424p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5790 PE=2 SV=1
13	PDB:6wqxC	0.263	0.594	1.186E-7	231	0.074	0.182	6wqxC.pdb.gz	Crystal structure of the human PRPK-TPRKB complex.
14	AFDB:H2KYA5	0.261	0.093	2.354E-6	1793	0.151	0.048	H2KYA5.pdb.gz	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
15	AFDB:F4HQ88	0.267	0.138	4.035E-6	1169	0.093	0.045	F4HQ88.pdb.gz	F4HQ88_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DYRKP-2A PE=1 SV=1
16	PDB:5u6yA	0.245	0.296	4.898E-6	459	0.106	0.131	5u6yA.pdb.gz
17	PDB:5yk1A	0.237	0.322	4.898E-6	401	0.065	0.092	5yk1A.pdb.gz	Discovery of the first macrolide antibiotic binding protein in Mycobacterium tuberculosis: a new antibiotic resistance drug target.
18	PDB:3uzsA	0.260	0.245	5.456E-6	609	0.100	0.094	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	PDB:6qx9K	0.236	0.398	5.758E-6	322	0.076	0.134	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:6khdB	0.252	0.410	8.399E-6	332	0.077	0.133	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRS2	0.0	1181	568	1.000	1.000	RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2
2	Q9VTL5	9.86e-156	460	585	0.423	0.410	Q9VTL5_DROME Serine/threonine-protein kinase RIO1 OS=Drosophila melanogaster OX=7227 GN=RIOK1 PE=2 SV=1
3	O44959	6.24e-131	394	506	0.382	0.429	RIOK1_CAEEL Serine/threonine-protein kinase RIO1 OS=Caenorhabditis elegans OX=6239 GN=riok-1 PE=2 SV=5
4	O42650	2.12e-122	371	497	0.414	0.473	RIO1_SCHPO Serine/threonine-protein kinase rio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio1 PE=3 SV=2
5	G5EAT2	5.24e-121	370	558	0.364	0.371	G5EAT2_EMENI Serine/threonine-protein kinase RIO1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06363 PE=3 SV=1
6	O14730	4.76e-86	278	519	0.238	0.260	RIOK3_HUMAN Serine/threonine-protein kinase RIO3 OS=Homo sapiens OX=9606 GN=RIOK3 PE=1 SV=2
7	Q12196	1.98e-81	265	484	0.268	0.314	RIO1_YEAST Serine/threonine-protein kinase RIO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIO1 PE=1 SV=1
8	Q9BVS4	9.90e-10	63.5	552	0.086	0.089	RIOK2_HUMAN Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2 PE=1 SV=2
9	P40160	1.35e-08	59.7	425	0.088	0.118	RIO2_YEAST Serine/threonine-protein kinase RIO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIO2 PE=1 SV=1
10	Q9P7W5	1.53e-07	55.8	344	0.077	0.128	RIO2_SCHPO Serine/threonine-protein kinase rio2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio2 PE=3 SV=2
11	Q9VBU2	4.34e-07	55.1	538	0.079	0.084	Q9VBU2_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=RIOK2 PE=3 SV=1
12	Q95Q34	3.82e-06	52.0	529	0.088	0.095	RIOK2_CAEEL Serine/threonine-protein kinase RIO2 OS=Caenorhabditis elegans OX=6239 GN=riok-2 PE=2 SV=2
13	O94547	0.11	37.7	580	0.113	0.110	SRK1_SCHPO Serine/threonine-protein kinase srk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srk1 PE=1 SV=1
14	Q9H093	0.19	37.0	628	0.048	0.043	NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens OX=9606 GN=NUAK2 PE=1 SV=1
15	B4E0Y5	0.20	37.0	672	0.048	0.040	B4E0Y5_HUMAN cDNA FLJ56013, highly similar to NUAK family SNF1-like kinase 2 OS=Homo sapiens OX=9606 PE=2 SV=1
16	Q584I8	0.46	35.8	647	0.037	0.032	Q584I8_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.710 PE=4 SV=1
17	Q6UVM3	1.5	34.3	1135	0.062	0.031	KCNT2_HUMAN Potassium channel subfamily T member 2 OS=Homo sapiens OX=9606 GN=KCNT2 PE=1 SV=1
18	Q66HE5	3.5	33.1	630	0.042	0.038	NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus OX=10116 GN=Nuak2 PE=1 SV=1
19	G3MTX3	3.8	33.1	884	0.030	0.019	G3MTX3_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tlk-1 PE=1 SV=1
20	Q2XN10	3.8	33.1	893	0.030	0.019	Q2XN10_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tlk-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	3.4	18.3	ABC1 atypical kinase-like domain
2	PF01636 APH	3.1	19.2	Phosphotransferase enzyme family
3	PF05808 Podoplanin	7.6e+02	11.8	Podoplanin
4	PF01163 RIO1	1.8e-74	260.9	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369162

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268802	0.998	RNA-binding protein NOB1
2	9606.ENSP00000319169	0.998	Protein arginine N-methyltransferase 5
3	9606.ENSP00000263657	0.996	RNA-binding protein PNO1
4	9606.ENSP00000301364	0.982	Pre-rRNA-processing protein TSR1 homolog
5	9606.ENSP00000385958	0.982	Ribosomal protein S14
6	9606.ENSP00000230340	0.981	Bystin
7	9606.ENSP00000341885	0.980	Ribosomal protein S2
8	9606.ENSP00000472985	0.980	Ribosomal protein S5
9	9606.ENSP00000235090	0.977	Methylosome protein 50
10	9606.ENSP00000467466	0.977	Ribosomal protein S15
11	9606.ENSP00000356548	0.975	Protein LTV1 homolog
12	9606.ENSP00000348849	0.973	Ribosomal protein S26
13	9606.ENSP00000481646	0.973	40S ribosomal protein S10
14	9606.ENSP00000346050	0.970	40S ribosomal protein S3a
15	9606.ENSP00000283109	0.969	Serine/threonine-protein kinase RIO2
16	9606.ENSP00000270625	0.965	Ribosomal protein S11
17	9606.ENSP00000379888	0.965	Ribosomal protein S8
18	9606.ENSP00000429374	0.965	Ribosomal protein S20
19	9606.ENSP00000251453	0.964	Ribosomal protein S16
20	9606.ENSP00000339095	0.963	40S ribosomal protein S7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.592	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0034641	0.988	cellular nitrogen compound metabolic process
GO:0044085	0.987	cellular component biogenesis
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0010467	0.983	gene expression
GO:0050794	0.982	regulation of cellular process
GO:0022613	0.980	ribonucleoprotein complex biogenesis
GO:0006139	0.965	nucleobase-containing compound metabolic process
GO:0009893	0.958	positive regulation of metabolic process
GO:0090304	0.945	nucleic acid metabolic process
GO:0048522	0.943	positive regulation of cellular process
GO:0031323	0.930	regulation of cellular metabolic process
GO:0016072	0.905	rRNA metabolic process
GO:0034470	0.901	ncRNA processing
GO:0042254	0.898	ribosome biogenesis
GO:0051171	0.895	regulation of nitrogen compound metabolic process
GO:0006364	0.893	rRNA processing
GO:0080090	0.889	regulation of primary metabolic process
GO:0042274	0.825	ribosomal small subunit biogenesis
GO:0010604	0.798	positive regulation of macromolecule metabolic process
GO:0030490	0.706	maturation of SSU-rRNA
GO:0010468	0.648	regulation of gene expression
GO:0019219	0.629	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.595	positive regulation of nitrogen compound metabolic process
GO:0031325	0.580	positive regulation of cellular metabolic process
GO:0051252	0.394	regulation of RNA metabolic process
GO:0045935	0.343	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.329	positive regulation of RNA metabolic process
GO:1901564	0.304	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:1990904	0.987	ribonucleoprotein complex
GO:0043228	0.965	non-membrane-bounded organelle
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:1902494	0.895	catalytic complex
GO:0030688	0.851	preribosome, small subunit precursor
GO:1990234	0.808	transferase complex
GO:0005730	0.737	nucleolus
GO:0034708	0.710	methyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]