StarFunc result for job id Q9BRS8

User Input

>input (491 residues)
MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAGDPARYLSPGWGSASEE
EPSRGHSGTTASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVR
RNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVRRTTPVPLFPNEN
LPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELP
PDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFMITESQGKENMKAVLIGMKPPKKKP
AKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNK
LSPSGHQNLFLSPNASPCTSPWSSPLAQRKGVSRKSPLAEEGRLNCSTSPEIFRKCMDYS
SDSSVTPSGSPWVRRRRQAEMGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRG
FHGHERSRACV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BN59	0.499	0.498	4.257E-73	492	0.912	0.911	Q8BN59.pdb.gz	LARP6_MOUSE La-related protein 6 OS=Mus musculus OX=10090 GN=Larp6 PE=1 SV=1
2	AFDB:A1Z9R1	0.258	0.165	8.390E-22	867	0.263	0.149	A1Z9R1.pdb.gz	A1Z9R1_DROME Achilles, isoform A OS=Drosophila melanogaster OX=7227 GN=Achl PE=2 SV=1
3	PDB:7lmaH	0.168	0.396	1.604E-5	199	0.067	0.166	7lmaH.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
4	AFDB:B8BCZ8	0.165	0.119	2.057E-4	738	0.149	0.099	B8BCZ8.pdb.gz	FCA_ORYSI Flowering time control protein FCA OS=Oryza sativa subsp. indica OX=39946 GN=FCA PE=3 SV=2
5	AFDB:G5EF03	0.127	0.109	2.186E-4	584	0.155	0.130	G5EF03.pdb.gz	G5EF03_CAEEL ELAV-type RNA binding protein variant A OS=Caenorhabditis elegans OX=6239 GN=etr-1 PE=1 SV=1
6	AFDB:A8DYS0	0.132	0.117	4.273E-4	588	0.157	0.131	A8DYS0.pdb.gz	A8DYS0_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=etr-1 PE=1 SV=1
7	PDB:6y5qq	0.145	0.371	6.602E-4	178	0.047	0.129	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
8	AFDB:J3KPK3	0.127	0.135	8.354E-4	459	0.104	0.111	J3KPK3.pdb.gz	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
9	AFDB:A6NDE4	0.127	0.125	9.437E-4	496	0.102	0.101	A6NDE4.pdb.gz	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
10	PDB:5vsuA	0.135	0.166	2.850E-3	387	0.045	0.057	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
11	PDB:6c0fo	0.132	0.439	2.850E-3	133	0.045	0.165	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
12	AFDB:O35698	0.120	0.153	3.004E-3	380	0.084	0.108	O35698.pdb.gz	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
13	AFDB:A3AT67	0.129	0.096	3.394E-3	684	0.116	0.083	A3AT67.pdb.gz	A3AT67_ORYSJ Branchpoint-bridging protein OS=Oryza sativa subsp. japonica OX=39947 GN=OsJ_14553 PE=3 SV=1
14	AFDB:A0A2R8QGL1	0.135	0.078	4.074E-3	927	0.084	0.044	A0A2R8QGL1.pdb.gz
15	PDB:3lqvB	0.132	0.494	4.641E-3	115	0.031	0.130	3lqvB.pdb.gz	Branch Recognition by SF3b14
16	PDB:5gm6R	0.150	0.268	6.295E-3	261	0.041	0.077	5gm6R.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:5xjcw	0.125	0.582	6.690E-3	91	0.033	0.176	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
18	PDB:1hl6A	0.129	0.475	7.111E-3	119	0.031	0.126	1hl6A.pdb.gz
19	PDB:6ff7X	0.137	0.373	7.558E-3	171	0.033	0.094	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:6gd1A	0.118	0.285	1.089E-2	190	0.029	0.074	6gd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BN59	0.0	860	492	0.912	0.911	LARP6_MOUSE La-related protein 6 OS=Mus musculus OX=10090 GN=Larp6 PE=1 SV=1
2	Q9BRS8	0.0	1012	491	1.000	1.000	LARP6_HUMAN La-related protein 6 OS=Homo sapiens OX=9606 GN=LARP6 PE=1 SV=1
3	Q6PHD4	9.57e-146	428	485	0.530	0.536	Q6PHD4_DANRE La ribonucleoprotein 6, translational regulator a OS=Danio rerio OX=7955 GN=zgc:66107 PE=1 SV=1
4	A1Z9R1	1.32e-39	155	867	0.198	0.112	A1Z9R1_DROME Achilles, isoform A OS=Drosophila melanogaster OX=7227 GN=Achl PE=2 SV=1
5	O80567	1.11e-18	91.3	545	0.112	0.101	LRP6B_ARATH La-related protein 6B OS=Arabidopsis thaliana OX=3702 GN=LARP6B PE=1 SV=2
6	Q7ZWE3	2.15e-14	77.8	555	0.126	0.112	LARP7_DANRE La-related protein 7 OS=Danio rerio OX=7955 GN=larp7 PE=2 SV=1
7	D6RF49	2.91e-14	71.2	119	0.065	0.269	D6RF49_HUMAN La ribonucleoprotein 7, transcriptional regulator (Fragment) OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1
8	D6RFF0	1.01e-13	73.9	299	0.116	0.191	D6RFF0_HUMAN La-related protein 7 (Fragment) OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1
9	Q05CL8	1.08e-13	75.9	570	0.118	0.102	LARP7_MOUSE La-related protein 7 OS=Mus musculus OX=10090 GN=Larp7 PE=1 SV=2
10	Q4G0J3	3.57e-13	73.9	582	0.116	0.098	LARP7_HUMAN La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1
11	Q38C07	2.95e-12	70.1	335	0.102	0.149	Q38C07_TRYB2 La protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5360 PE=4 SV=1
12	Q9N9G6	2.95e-12	70.1	335	0.102	0.149	Q9N9G6_9TRYP La protein OS=Trypanosoma brucei OX=5691 GN=La PE=2 SV=1
13	Q9NIH4	3.11e-12	70.1	335	0.102	0.149	Q9NIH4_9TRYP RNA binding protein La-like protein OS=Trypanosoma brucei OX=5691 PE=1 SV=1
14	Q9W362	1.56e-11	68.9	595	0.071	0.059	Q9W362_DROME La-related protein 7 OS=Drosophila melanogaster OX=7227 GN=Larp7 PE=1 SV=1
15	Q54TG6	1.71e-11	67.8	354	0.063	0.088	Q54TG6_DICDI Lupus La protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281763 PE=1 SV=1
16	D5MCN2	3.03e-09	62.0	1150	0.071	0.030	LARP1_CAEEL La-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=larp-1 PE=4 SV=2
17	Q940X9	2.78e-08	58.9	826	0.057	0.034	LRP1A_ARATH La-related protein 1A OS=Arabidopsis thaliana OX=3702 GN=LARP1A PE=1 SV=1
18	F4K704	2.79e-08	58.9	833	0.057	0.034	F4K704_ARATH LA RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=LARP1A PE=1 SV=1
19	Q6PKG0	4.00e-08	58.5	1096	0.069	0.031	LARP1_HUMAN La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2
20	P05455	7.84e-08	57.0	408	0.059	0.071	LA_HUMAN Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20042 DUF6444	6e+02	12.4	Family of unknown function (DUF6444)
2	PF05383 La	5.4e-17	72.8	La domain
3	PF00076 RRM_1	47	15.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF12901 SUZ-C	7.5e-06	37.0	SUZ-C motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299213

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392270	0.944	Serine-threonine kinase receptor-associated protein
2	9606.ENSP00000356520	0.792	ATP-dependent RNA helicase A
3	9606.ENSP00000330433	0.779	TM2 domain containing 3
4	9606.ENSP00000216330	0.748	Peptidyl-prolyl cis-trans isomerase FKBP3
5	9606.ENSP00000482767	0.746	La-related protein 4B
6	9606.ENSP00000367408	0.745	Peripheral plasma membrane protein CASK
7	9606.ENSP00000381490	0.737	La-related protein 4
8	9606.ENSP00000321179	0.703	RNA-binding protein 44
9	9606.ENSP00000398744	0.656	Adenosine deaminase-like protein
10	9606.ENSP00000406164	0.622	Geminin coiled-coil domain-containing protein 1
11	9606.ENSP00000367038	0.619	Ribosome-binding protein 1
12	9606.ENSP00000243253	0.592	Protein transport protein Sec61 subunit alpha isoform 1
13	9606.ENSP00000338093	0.588	Probable threonine--tRNA ligase 2, cytoplasmic
14	9606.ENSP00000239440	0.566	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3
15	9606.ENSP00000182527	0.554	Translocating chain-associated membrane protein 2
16	9606.ENSP00000450857	0.551	Stonin-2
17	9606.ENSP00000453273	0.546	Leucine-rich repeat-containing protein 49
18	9606.ENSP00000244217	0.537	Methylmalonyl-CoA epimerase, mitochondrial
19	9606.ENSP00000297268	0.525	Collagen alpha-2(I) chain
20	9606.ENSP00000313007	0.523	Polyadenylate-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.996	RNA binding
GO:0003729	0.518	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0006417	0.983	regulation of translation
GO:0031325	0.982	positive regulation of cellular metabolic process
GO:0034250	0.981	positive regulation of amide metabolic process
GO:0045727	0.965	positive regulation of translation
GO:0010712	0.776	regulation of collagen metabolic process
GO:0065009	0.703	regulation of molecular function
GO:0051098	0.676	regulation of binding
GO:0010714	0.676	positive regulation of collagen metabolic process
GO:0044093	0.492	positive regulation of molecular function
GO:0009987	0.487	cellular process
GO:0051099	0.375	positive regulation of binding
GO:0032965	0.321	regulation of collagen biosynthetic process
GO:0032967	0.311	positive regulation of collagen biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:1990904	0.997	ribonucleoprotein complex
GO:0005844	0.988	polysome
GO:0005829	0.917	cytosol
GO:0070013	0.915	intracellular organelle lumen
GO:0031981	0.459	nuclear lumen
GO:0005654	0.448	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]