StarFunc result for job id Q9BRT2

User Input

>input (126 residues)
MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESL
ARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGP
EEDHKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CQY6	0.958	0.889	1.878E-17	136	0.897	0.831	Q9CQY6.pdb.gz	UQCC2_MOUSE Ubiquinol-cytochrome c reductase complex assembly factor 2 OS=Mus musculus OX=10090 GN=Uqcc2 PE=1 SV=1
2	AFDB:Q5TAQ0	0.350	0.434	2.895E-12	101	0.802	1.000	Q5TAQ0.pdb.gz	Q5TAQ0_HUMAN Ubiquinol-cytochrome-c reductase complex assembly factor 2 OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1
3	AFDB:Q57WX7	0.378	0.320	1.508E-1	154	0.175	0.143	Q57WX7.pdb.gz	Q57WX7_TRYB2 Complex 1 LYR protein domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.470 PE=4 SV=1
4	AFDB:Q9CQB7	0.258	0.264	2.300E-1	122	0.183	0.189	Q9CQB7.pdb.gz	LYRM1_MOUSE LYR motif-containing protein 1 OS=Mus musculus OX=10090 GN=Lyrm1 PE=1 SV=1
5	AFDB:A0A2R8QJD2	0.195	0.049	3.509E-1	644	0.167	0.033	A0A2R8QJD2.pdb.gz
6	AFDB:Q57Z79	0.273	0.183	4.745E-1	216	0.183	0.106	Q57Z79.pdb.gz	Q57Z79_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.150 PE=4 SV=1
7	AFDB:Q8SZ16	0.264	0.275	9.214E-1	120	0.143	0.150	Q8SZ16.pdb.gz	SDHF3_DROME Succinate dehydrogenase assembly factor 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Sdhaf3 PE=2 SV=1
8	AFDB:A0A0S2Z5H3	0.234	0.057	1.246	643	0.167	0.033	A0A0S2Z5H3.pdb.gz	A0A0S2Z5H3_HUMAN Clathrin interactor 1 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=CLINT1 PE=2 SV=1
9	PDB:7qskV	0.311	0.337	1.247	115	0.079	0.087	7qskV.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
10	AFDB:P36631	0.172	0.068	1.323	468	0.127	0.034	P36631.pdb.gz	STE11_SCHPO Transcription factor ste11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ste11 PE=1 SV=2
11	AFDB:Q9CQJ8	0.217	0.171	1.323	179	0.183	0.128	Q9CQJ8.pdb.gz	NDUB9_MOUSE NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Mus musculus OX=10090 GN=Ndufb9 PE=1 SV=3
12	PDB:6uxeB	0.233	0.315	1.903	85	0.111	0.165	6uxeB.pdb.gz	The essential function of ISCU2 and its conserved N-terminus in Fe/S cluster biogenesis
13	PDB:7qsmW	0.283	0.303	2.021	116	0.119	0.129	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
14	PDB:7b93n	0.200	0.160	2.147	178	0.183	0.129	7b93n.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
15	PDB:6sklB	0.234	0.163	2.280	193	0.135	0.088	6sklB.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
16	PDB:7edxc	0.202	0.201	3.275	127	0.143	0.142	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
17	PDB:1y11A	0.252	0.116	3.478	364	0.151	0.052	1y11A.pdb.gz
18	PDB:7aqrV	0.332	0.304	4.703	140	0.087	0.079	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
19	PDB:7khwA	0.176	0.139	5.306	174	0.151	0.109	7khwA.pdb.gz
20	PDB:5iy6U	0.254	0.206	5.636	170	0.190	0.141	5iy6U.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRT2	1.49e-91	262	126	1.000	1.000	UQCC2_HUMAN Ubiquinol-cytochrome c reductase complex assembly factor 2 OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1
2	V5IRT4	1.66e-90	259	126	0.992	0.992	V5IRT4_HUMAN Ubiquinol-cytochrome-c reductase complex assembly factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1
3	Q9CQY6	9.50e-84	243	136	0.913	0.846	UQCC2_MOUSE Ubiquinol-cytochrome c reductase complex assembly factor 2 OS=Mus musculus OX=10090 GN=Uqcc2 PE=1 SV=1
4	Q5TAQ0	2.58e-65	194	101	0.802	1.000	Q5TAQ0_HUMAN Ubiquinol-cytochrome-c reductase complex assembly factor 2 OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1
5	O96553	0.64	31.6	968	0.079	0.010	C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=pug PE=2 SV=4
6	O08569	1.5	30.4	533	0.175	0.041	ZP3R_CAVPO Zona pellucida sperm-binding protein 3 receptor OS=Cavia porcellus OX=10141 GN=ZP3R PE=1 SV=1
7	Q9W0E9	2.9	29.6	485	0.230	0.060	Q9W0E9_DROME Stem cell tumor, isoform B OS=Drosophila melanogaster OX=7227 GN=stet PE=4 SV=2
8	P14873	5.1	29.3	2464	0.151	0.008	MAP1B_MOUSE Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2
9	Q728Z2	5.4	28.5	197	0.095	0.061	Q728Z2_DESVH Uncharacterized protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2460 PE=1 SV=1
10	P15205	6.4	28.9	2461	0.151	0.008	MAP1B_RAT Microtubule-associated protein 1B OS=Rattus norvegicus OX=10116 GN=Map1b PE=1 SV=3
11	Q0D5R3	6.8	28.5	695	0.111	0.020	CRK6_ORYSJ Cysteine-rich receptor-like protein kinase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=CRK6 PE=1 SV=1
12	Q8IUD2	8.1	28.5	1116	0.238	0.027	RB6I2_HUMAN ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1
13	Q99MI1	8.5	28.5	1120	0.238	0.027	RB6I2_MOUSE ELKS/Rab6-interacting/CAST family member 1 OS=Mus musculus OX=10090 GN=Erc1 PE=1 SV=1
14	Q811U3	8.7	28.5	948	0.238	0.032	RB6I2_RAT ELKS/Rab6-interacting/CAST family member 1 OS=Rattus norvegicus OX=10116 GN=Erc1 PE=1 SV=1
15	Q54WG5	9.7	28.1	754	0.127	0.021	Q54WG5_DICDI Fanconi Anaemia group E protein C-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279669 PE=4 SV=1
16	Q9FLZ6	9.8	28.1	507	0.103	0.026	Q9FLZ6_ARATH Emb

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05347 Complex1_LYR	48	15.4	Complex 1 protein (LYR family)
2	PF20180 UQCC2_CBP6	1.1e-19	82.1	Complex III assembly factor UQCC2/CBP6

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000476140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363506	0.991	Ubiquinol-cytochrome-c reductase complex assembly factor 1
2	9606.ENSP00000467262	0.803	Cytochrome b-c1 complex subunit 10
3	9606.ENSP00000406327	0.784	Cytochrome c oxidase protein 20 homolog
4	9606.ENSP00000252102	0.746	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
5	9606.ENSP00000215375	0.726	ATP synthase subunit delta, mitochondrial
6	9606.ENSP00000317376	0.714	Mitochondrial ribosomal protein S11
7	9606.ENSP00000432692	0.697	Ubiquinol-cytochrome-c reductase complex assembly factor 3
8	9606.ENSP00000323065	0.678	Growth arrest and DNA damage-inducible proteins-interacting protein 1
9	9606.ENSP00000261647	0.658	Tetratricopeptide repeat protein 19, mitochondrial
10	9606.ENSP00000332887	0.640	Cytochrome b-c1 complex subunit 9
11	9606.ENSP00000413908	0.640	Mitochondrial chaperone BCS1
12	9606.ENSP00000368688	0.624	Complex III assembly factor LYRM7
13	9606.ENSP00000367939	0.619	Cytochrome b-c1 complex subunit 8
14	9606.ENSP00000424870	0.617	Signal recognition particle 19 kDa protein
15	9606.ENSP00000305892	0.599	Transmembrane protein 208
16	9606.ENSP00000253047	0.565	Transmembrane protein 160
17	9606.ENSP00000418842	0.565	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
18	9606.ENSP00000381859	0.563	Mitochondrial import receptor subunit TOM6 homolog
19	9606.ENSP00000368523	0.562	DnaJ homolog subfamily C member 15
20	9606.ENSP00000223136	0.555	Mitochondrial fission 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.552	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043933	0.990	protein-containing complex organization
GO:0022607	0.990	cellular component assembly
GO:0007005	0.989	mitochondrion organization
GO:0033108	0.978	mitochondrial respiratory chain complex assembly
GO:0017004	0.952	cytochrome complex assembly
GO:0050794	0.951	regulation of cellular process
GO:0048518	0.940	positive regulation of biological process
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0062125	0.933	regulation of mitochondrial gene expression
GO:0051171	0.930	regulation of nitrogen compound metabolic process
GO:2000112	0.899	regulation of cellular macromolecule biosynthetic process
GO:0034248	0.898	regulation of amide metabolic process
GO:0045727	0.879	positive regulation of translation
GO:0043467	0.821	regulation of generation of precursor metabolites and energy
GO:0070129	0.773	regulation of mitochondrial translation
GO:0043457	0.618	regulation of cellular respiration
GO:1903715	0.546	regulation of aerobic respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	1.000	intracellular organelle lumen
GO:0005739	1.000	mitochondrion
GO:0005634	0.991	nucleus
GO:0031981	0.974	nuclear lumen
GO:0043232	0.943	intracellular non-membrane-bounded organelle
GO:0031966	0.935	mitochondrial membrane
GO:0019866	0.930	organelle inner membrane
GO:0005654	0.923	nucleoplasm
GO:0005743	0.916	mitochondrial inner membrane
GO:0016604	0.870	nuclear body
GO:0005759	0.834	mitochondrial matrix
GO:0032991	0.633	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]