StarFunc result for job id Q9BRT3

User Input

>input (115 residues)
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLG
GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRT3	1.000	1.000	2.213E-25	115	1.000	1.000	Q9BRT3.pdb.gz	MIEN1_HUMAN Migration and invasion enhancer 1 OS=Homo sapiens OX=9606 GN=MIEN1 PE=1 SV=1
2	AFDB:Q9CQ86	0.887	0.887	2.675E-22	115	0.896	0.896	Q9CQ86.pdb.gz	MIEN1_MOUSE Migration and invasion enhancer 1 OS=Mus musculus OX=10090 GN=Mien1 PE=1 SV=1
3	AFDB:J3KTI2	0.657	0.652	4.758E-16	116	0.765	0.759	J3KTI2.pdb.gz	J3KTI2_HUMAN Migration and invasion enhancer 1 OS=Homo sapiens OX=9606 GN=MIEN1 PE=1 SV=1
4	PDB:2ljkA	0.719	0.708	6.609E-16	117	1.000	0.983	2ljkA.pdb.gz
5	AFDB:F1Q7W2	0.618	0.563	1.726E-5	127	0.191	0.173	F1Q7W2.pdb.gz
6	PDB:2npbA	0.604	0.771	6.016E-5	88	0.209	0.273	2npbA.pdb.gz
7	AFDB:Q8W1E5	0.676	0.352	8.356E-5	228	0.243	0.123	Q8W1E5.pdb.gz	Q8W1E5_ARATH AT5g58640/mzn1_90 OS=Arabidopsis thaliana OX=3702 GN=MZN1.9 PE=1 SV=1
8	AFDB:Q9VMV6	0.644	0.379	4.914E-3	198	0.200	0.116	Q9VMV6.pdb.gz	SELT_DROME Thioredoxin reductase-like selenoprotein T homolog CG3887 OS=Drosophila melanogaster OX=7227 GN=SelT PE=2 SV=1
9	AFDB:Q8N427	0.357	0.104	5.248E-3	588	0.139	0.027	Q8N427.pdb.gz	TXND3_HUMAN Thioredoxin domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NME8 PE=2 SV=2
10	AFDB:Q6IRC5	0.446	0.107	6.392E-3	625	0.148	0.027	Q6IRC5.pdb.gz	TXND6_XENLA Thioredoxin domain-containing protein 6 OS=Xenopus laevis OX=8355 GN=nme9 PE=2 SV=1
11	PDB:6gd1A	0.454	0.299	9.480E-3	190	0.130	0.079	6gd1A.pdb.gz
12	PDB:3f3qA	0.340	0.353	1.502E-2	109	0.096	0.101	3f3qA.pdb.gz	Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
13	PDB:6iblA	0.458	0.159	1.604E-2	397	0.113	0.033	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
14	PDB:6lurD	0.466	0.280	1.604E-2	213	0.139	0.075	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.
15	PDB:7nvmP	0.427	0.292	1.713E-2	190	0.113	0.068	7nvmP.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
16	AFDB:O48949	0.317	0.087	1.713E-2	532	0.165	0.036	O48949.pdb.gz	O48949_CHLRE Protein disulfide-isomerase OS=Chlamydomonas reinhardtii OX=3055 GN=PDI PE=2 SV=1
17	AFDB:Q8IFW4	0.346	0.282	1.829E-2	157	0.122	0.089	Q8IFW4.pdb.gz	THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster OX=7227 GN=TrxT PE=1 SV=1
18	PDB:7scdA	0.404	0.152	1.953E-2	371	0.122	0.038	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate
19	PDB:5xocB	0.456	0.406	2.228E-2	133	0.165	0.143	5xocB.pdb.gz
20	PDB:3ul3A	0.443	0.484	2.541E-2	103	0.096	0.107	3ul3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRT3	3.12e-78	227	115	1.000	1.000	MIEN1_HUMAN Migration and invasion enhancer 1 OS=Homo sapiens OX=9606 GN=MIEN1 PE=1 SV=1
2	Q9CQ86	3.89e-63	189	115	0.896	0.896	MIEN1_MOUSE Migration and invasion enhancer 1 OS=Mus musculus OX=10090 GN=Mien1 PE=1 SV=1
3	J3KTI2	9.48e-59	178	116	0.791	0.784	J3KTI2_HUMAN Migration and invasion enhancer 1 OS=Homo sapiens OX=9606 GN=MIEN1 PE=1 SV=1
4	P59797	4.99e-06	45.8	346	0.209	0.069	SELV_HUMAN Selenoprotein V OS=Homo sapiens OX=9606 GN=SELENOV PE=1 SV=2
5	P63300	4.56e-05	41.2	88	0.235	0.307	SELW_MOUSE Selenoprotein W OS=Mus musculus OX=10090 GN=Selenow PE=1 SV=3
6	P63301	4.56e-05	41.2	88	0.235	0.307	SELW_RAT Selenoprotein W OS=Rattus norvegicus OX=10116 GN=Selenow PE=1 SV=3
7	Q8W1E5	0.001	38.5	228	0.183	0.092	Q8W1E5_ARATH AT5g58640/mzn1_90 OS=Arabidopsis thaliana OX=3702 GN=MZN1.9 PE=1 SV=1
8	P62341	0.009	36.2	195	0.148	0.087	SELT_HUMAN Thioredoxin reductase-like selenoprotein T OS=Homo sapiens OX=9606 GN=SELENOT PE=1 SV=2
9	P62342	0.011	36.2	195	0.148	0.087	SELT_MOUSE Thioredoxin reductase-like selenoprotein T OS=Mus musculus OX=10090 GN=Selenot PE=1 SV=2
10	Q1H5H1	0.011	36.2	195	0.148	0.087	SELT_RAT Thioredoxin reductase-like selenoprotein T OS=Rattus norvegicus OX=10116 GN=Selenot PE=1 SV=2
11	Q9VMV6	0.039	34.7	198	0.157	0.091	SELT_DROME Thioredoxin reductase-like selenoprotein T homolog CG3887 OS=Drosophila melanogaster OX=7227 GN=SelT PE=2 SV=1
12	Q8BI79	0.38	32.0	1192	0.287	0.028	CCD40_MOUSE Coiled-coil domain-containing protein 40 OS=Mus musculus OX=10090 GN=Ccdc40 PE=1 SV=1
13	Q9N554	1.00	30.8	678	0.139	0.024	Q9N554_CAEEL OCEL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ell-1 PE=1 SV=2
14	Q9Z2Y2	1.0	30.8	369	0.165	0.051	B4GT2_MOUSE Beta-1,4-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B4galt2 PE=2 SV=1
15	Q90ZH5	2.9	28.9	153	0.165	0.124	Q90ZH5_CHICK Histone deacetylase complex subunit SAP18 OS=Gallus gallus OX=9031 GN=chSAP18 PE=1 SV=1
16	Q9R0M8	3.3	29.3	390	0.104	0.031	S35A2_MOUSE UDP-galactose translocator OS=Mus musculus OX=10090 GN=Slc35a2 PE=1 SV=1
17	P78381	3.7	28.9	396	0.104	0.030	S35A2_HUMAN UDP-galactose translocator OS=Homo sapiens OX=9606 GN=SLC35A2 PE=1 SV=1
18	Q4H4F7	3.8	28.9	604	0.130	0.025	BTRL_NIACI Neamine phosphoribosyltransferase OS=Niallia circulans OX=1397 GN=btrL PE=1 SV=1
19	B4DE15	4.4	28.9	406	0.104	0.030	B4DE15_HUMAN Solute carrier family 35 member A2 OS=Homo sapiens OX=9606 GN=SLC35A2 PE=1 SV=1
20	Q9C9F6	6.6	28.5	755	0.096	0.015	APRR6_ARATH Putative two-component response regulator-like APRR6 OS=Arabidopsis thaliana OX=3702 GN=APRR6 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10262 Rdx	3.2e-14	64.2	Rdx family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377778

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300658	0.926	Post-GPI attachment to proteins factor 3
2	9606.ENSP00000418910	0.835	Selenoprotein with thioredoxin reductase-like oxidoreductase activity (By similarity). Protects dopaminergic neurons against oxidative stress ans cell death . Involved in ADCYAP1/PACAP-induced calcium mobilization and neuroendocrine secretion (By similarity). Plays a role in fibroblast anchorage and redox regulation (By similarity). In gastric smooth muscle, modulates the contraction processes through the regulation of calcium release and MYLK activation (By similarity). In pancreatic islets, involved in the control of glucose homeostasis, contributes to prolonged ADCYAP1/PACAP- induce [...]
3	9606.ENSP00000473185	0.816	Selenoprotein W
4	9606.ENSP00000337446	0.790	StAR-related lipid transfer protein 3
5	9606.ENSP00000312624	0.785	Telethonin
6	9606.ENSP00000403459	0.754	Growth factor receptor-bound protein 7
7	9606.ENSP00000262746	0.727	Peroxiredoxin-1
8	9606.ENSP00000247225	0.672	Sphingosine-1-phosphate phosphatase 1
9	9606.ENSP00000436047	0.666	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
10	9606.ENSP00000363041	0.659	CDGSH iron-sulfur domain-containing protein 1
11	9606.ENSP00000402756	0.651	Nuclear receptor 2C2-associated protein
12	9606.ENSP00000407375	0.638	Glutathione peroxidase 1
13	9606.ENSP00000269571	0.632	Receptor tyrosine-protein kinase erbB-2
14	9606.ENSP00000216267	0.607	Bromodomain-containing protein 1
15	9606.ENSP00000168216	0.594	3-hydroxyacyl-CoA dehydrogenase type-2
16	9606.ENSP00000305892	0.560	Transmembrane protein 208
17	9606.ENSP00000295256	0.549	Hematopoietic prostaglandin D synthase
18	9606.ENSP00000363641	0.537	Thioredoxin
19	9606.ENSP00000254079	0.535	Protein phosphatase 1 regulatory subunit 1B
20	9606.ENSP00000483688	0.533	Proteasome subunit beta type-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044089	0.995	positive regulation of cellular component biogenesis
GO:0120034	0.990	positive regulation of plasma membrane bounded cell projection assembly
GO:2000145	0.988	regulation of cell motility
GO:0060548	0.988	negative regulation of cell death
GO:0051489	0.986	regulation of filopodium assembly
GO:0040017	0.979	positive regulation of locomotion
GO:0043069	0.979	negative regulation of programmed cell death
GO:0042981	0.976	regulation of apoptotic process
GO:0030334	0.968	regulation of cell migration
GO:0043066	0.967	negative regulation of apoptotic process
GO:2000147	0.965	positive regulation of cell motility
GO:0051491	0.954	positive regulation of filopodium assembly
GO:0030335	0.938	positive regulation of cell migration
GO:0009987	0.707	cellular process
GO:0071704	0.427	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.997	intracellular organelle
GO:0031981	0.985	nuclear lumen
GO:0005654	0.983	nucleoplasm
GO:0016020	0.971	membrane
GO:0005886	0.904	plasma membrane
GO:0043232	0.876	intracellular non-membrane-bounded organelle
GO:0005856	0.379	cytoskeleton
GO:0015630	0.333	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]