StarFunc result for job id Q9BRT9

User Input

>input (223 residues)
MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEH
MEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPS
SLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQE
NILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BRT9	1.000	1.000	9.071E-41	223	1.000	1.000	Q9BRT9.pdb.gz	SLD5_HUMAN DNA replication complex GINS protein SLD5 OS=Homo sapiens OX=9606 GN=GINS4 PE=1 SV=1
2	AFDB:Q99LZ3	0.945	0.945	7.317E-37	223	0.879	0.879	Q99LZ3.pdb.gz	SLD5_MOUSE DNA replication complex GINS protein SLD5 OS=Mus musculus OX=10090 GN=Gins4 PE=1 SV=1
3	AFDB:Q7ZT48	0.959	0.967	2.472E-33	221	0.709	0.715	Q7ZT48.pdb.gz	SLD5_XENLA DNA replication complex GINS protein SLD5 OS=Xenopus laevis OX=8355 GN=gins4 PE=1 SV=1
4	PDB:6xtxD	0.871	0.953	4.465E-31	203	0.910	1.000	6xtxD.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
5	AFDB:Q9VBI1	0.883	0.865	2.318E-21	228	0.363	0.355	Q9VBI1.pdb.gz	Q9VBI1_DROME DNA replication complex GINS protein SLD5 OS=Drosophila melanogaster OX=7227 GN=Sld5 PE=1 SV=1
6	AFDB:Q9U2W9	0.864	0.860	4.465E-17	224	0.305	0.304	Q9U2W9.pdb.gz	Q9U2W9_CAEEL DNA replication complex GINS protein SLD5 OS=Caenorhabditis elegans OX=6239 GN=sld-5 PE=1 SV=2
7	AFDB:Q6NQP5	0.788	0.798	7.104E-17	220	0.305	0.309	Q6NQP5.pdb.gz	SLD5_ARATH DNA replication complex GINS protein SLD5 OS=Arabidopsis thaliana OX=3702 GN=SLD5 PE=1 SV=1
8	AFDB:Q582Q4	0.767	0.617	8.779E-15	283	0.247	0.194	Q582Q4.pdb.gz	Q582Q4_TRYB2 DNA replication complex GINS protein SLD5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.420 PE=3 SV=1
9	AFDB:Q9P7C8	0.799	0.831	1.174E-14	214	0.274	0.285	Q9P7C8.pdb.gz	SLD5_SCHPO DNA replication complex GINS protein sld5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sld5 PE=1 SV=1
10	AFDB:Q03406	0.806	0.621	9.481E-14	294	0.251	0.190	Q03406.pdb.gz	SLD5_YEAST DNA replication complex GINS protein SLD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLD5 PE=1 SV=1
11	PDB:6sklD	0.783	0.723	5.266E-13	243	0.242	0.222	6sklD.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
12	PDB:6raxN	0.745	0.794	1.616E-11	208	0.381	0.409	6raxN.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
13	AFDB:Q14691	0.424	0.475	2.300E-6	196	0.175	0.199	Q14691.pdb.gz	PSF1_HUMAN DNA replication complex GINS protein PSF1 OS=Homo sapiens OX=9606 GN=GINS1 PE=1 SV=1
14	PDB:6xtxA	0.391	0.437	4.495E-6	196	0.179	0.204	6xtxA.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
15	PDB:3jc5A	0.362	0.384	1.518E-2	208	0.175	0.188	3jc5A.pdb.gz
16	PDB:5oobF	0.250	0.086	7.275E-2	718	0.067	0.021	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
17	PDB:6gn0A	0.194	0.182	1.092E-1	239	0.076	0.071	6gn0A.pdb.gz
18	PDB:3feyA	0.182	0.072	4.660E-1	761	0.094	0.028	3feyA.pdb.gz
19	PDB:2zczA	0.140	0.354	6.229E-1	73	0.031	0.096	2zczA.pdb.gz	Intersubunit linker length as a modifier of protein stability: crystal structures and thermostability of mutant TRAP.
20	PDB:7vciR	0.152	0.037	6.996E-1	1082	0.067	0.014	7vciR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BRT9	4.67e-164	453	223	1.000	1.000	SLD5_HUMAN DNA replication complex GINS protein SLD5 OS=Homo sapiens OX=9606 GN=GINS4 PE=1 SV=1
2	Q99LZ3	3.11e-144	403	223	0.879	0.879	SLD5_MOUSE DNA replication complex GINS protein SLD5 OS=Mus musculus OX=10090 GN=Gins4 PE=1 SV=1
3	Q7ZT48	9.46e-117	333	221	0.717	0.724	SLD5_XENLA DNA replication complex GINS protein SLD5 OS=Xenopus laevis OX=8355 GN=gins4 PE=1 SV=1
4	Q9VBI1	1.03e-48	161	228	0.363	0.355	Q9VBI1_DROME DNA replication complex GINS protein SLD5 OS=Drosophila melanogaster OX=7227 GN=Sld5 PE=1 SV=1
5	Q9U2W9	2.47e-30	113	224	0.327	0.326	Q9U2W9_CAEEL DNA replication complex GINS protein SLD5 OS=Caenorhabditis elegans OX=6239 GN=sld-5 PE=1 SV=2
6	Q6NQP5	1.56e-25	101	220	0.323	0.327	SLD5_ARATH DNA replication complex GINS protein SLD5 OS=Arabidopsis thaliana OX=3702 GN=SLD5 PE=1 SV=1
7	Q9P7C8	1.03e-16	77.8	214	0.287	0.299	SLD5_SCHPO DNA replication complex GINS protein sld5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sld5 PE=1 SV=1
8	Q582Q4	1.66e-11	64.3	283	0.256	0.201	Q582Q4_TRYB2 DNA replication complex GINS protein SLD5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.420 PE=3 SV=1
9	Q03406	1.01e-09	59.3	294	0.256	0.194	SLD5_YEAST DNA replication complex GINS protein SLD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLD5 PE=1 SV=1
10	D9PTP3	0.006	37.4	95	0.121	0.284	D9PTP3_CAEEL DNA replication complex GINS protein SLD5 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sld-5 PE=1 SV=1
11	Q8VZG6	0.23	34.7	738	0.170	0.051	Q8VZG6_ARATH AT5g61910/k22g18_30 OS=Arabidopsis thaliana OX=3702 GN=At5g61910 PE=1 SV=1
12	Q3UWL9	1.3	32.7	944	0.117	0.028	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
13	Q3UHU5	1.7	32.3	1945	0.143	0.016	MTCL1_MOUSE Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1
14	X1WE18	1.8	32.0	1085	0.103	0.021	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
15	D9PTP4	1.9	29.6	73	0.103	0.315	D9PTP4_CAEEL DNA replication complex GINS protein SLD5 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sld-5 PE=1 SV=1
16	A0A1D8PH14	7.1	30.4	1768	0.085	0.011	A0A1D8PH14_CANAL Dck2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCK2 PE=3 SV=1
17	A0A0R4INY2	9.0	30.0	756	0.063	0.019	A0A0R4INY2_DANRE Periostin isoform X5 OS=Danio rerio OX=7955 GN=fa99h07 PE=1 SV=1
18	A0JMK0	9.0	30.0	756	0.063	0.019	A0JMK0_DANRE Periostin isoform 1 precursor OS=Danio rerio OX=7955 GN=postn PE=1 SV=1
19	Q54QM5	9.1	29.6	547	0.081	0.033	GPHR_DICDI Golgi pH regulator homolog OS=Dictyostelium discoideum OX=44689 GN=gpr89 PE=3 SV=1
20	A0A0R4IPF4	9.4	29.6	785	0.063	0.018	A0A0R4IPF4_DANRE Periostin isoform X2 OS=Danio rerio OX=7955 GN=fa99h07 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17436 DUF5415	1.7e+02	13.6	Family of unknown function (DUF5415)
2	PF05916 Sld5	0.00029	32.7	GINS complex protein
3	PF16922 SLD5_C	1.7e-13	61.9	DNA replication complex GINS protein SLD5 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216122	0.999	DNA replication licensing factor MCM5
2	9606.ENSP00000253462	0.999	DNA replication complex GINS protein PSF2
3	9606.ENSP00000262105	0.999	DNA replication licensing factor MCM4
4	9606.ENSP00000262460	0.999	DNA replication complex GINS protein PSF1
5	9606.ENSP00000264156	0.999	DNA replication licensing factor MCM6
6	9606.ENSP00000265056	0.999	DNA replication licensing factor MCM2
7	9606.ENSP00000307288	0.999	DNA replication licensing factor MCM7
8	9606.ENSP00000353793	0.999	WD repeat and HMG-box DNA-binding protein 1
9	9606.ENSP00000401018	0.999	GINS complex subunit 3
10	9606.ENSP00000405726	0.999	Cell division control protein 45 homolog
11	9606.ENSP00000480987	0.999	DNA replication licensing factor MCM3
12	9606.ENSP00000261881	0.998	TIMELESS-interacting protein
13	9606.ENSP00000418268	0.988	Protein MCM10 homolog
14	9606.ENSP00000450607	0.972	Protein timeless homolog
15	9606.ENSP00000322570	0.970	DNA polymerase epsilon catalytic subunit A
16	9606.ENSP00000368349	0.967	DNA polymerase alpha catalytic subunit
17	9606.ENSP00000314505	0.956	DNA helicase MCM9
18	9606.ENSP00000368164	0.944	DNA helicase MCM8
19	9606.ENSP00000216367	0.939	DNA polymerase epsilon subunit 2
20	9606.ENSP00000413632	0.931	Minichromosome maintenance domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0006259	0.979	DNA metabolic process
GO:0006260	0.965	DNA replication
GO:0050794	0.959	regulation of cellular process
GO:0019222	0.919	regulation of metabolic process
GO:0051052	0.893	regulation of DNA metabolic process
GO:0006261	0.885	DNA-templated DNA replication
GO:0071840	0.878	cellular component organization or biogenesis
GO:0016043	0.867	cellular component organization
GO:0071103	0.823	DNA conformation change
GO:0048518	0.793	positive regulation of biological process
GO:0032392	0.787	DNA geometric change
GO:0051054	0.780	positive regulation of DNA metabolic process
GO:0006275	0.761	regulation of DNA replication
GO:2000278	0.742	regulation of DNA biosynthetic process
GO:0032508	0.648	DNA duplex unwinding
GO:2000573	0.633	positive regulation of DNA biosynthetic process
GO:0065009	0.593	regulation of molecular function
GO:0050790	0.398	regulation of catalytic activity
GO:0006268	0.360	DNA unwinding involved in DNA replication
GO:0090329	0.349	regulation of DNA-templated DNA replication
GO:0044093	0.325	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005694	0.998	chromosome
GO:0140513	0.990	nuclear protein-containing complex
GO:0000228	0.990	nuclear chromosome
GO:0032993	0.987	protein-DNA complex
GO:0031261	0.944	DNA replication preinitiation complex
GO:0000811	0.914	GINS complex
GO:0005737	0.912	cytoplasm
GO:0071162	0.847	CMG complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]