StarFunc result for job id Q9BRX5

User Input

>input (216 residues)
MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAV
PQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFG
SQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQ
KGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z5L0	0.950	0.950	1.089E-37	216	1.000	1.000	A0A0S2Z5L0.pdb.gz	A0A0S2Z5L0_HUMAN DNA replication complex GINS protein PSF3 (Fragment) OS=Homo sapiens OX=9606 GN=GINS3 PE=2 SV=1
2	AFDB:A0A0S2Z5P2	0.884	0.754	2.765E-33	255	0.991	0.839	A0A0S2Z5P2.pdb.gz	A0A0S2Z5P2_HUMAN DNA replication complex GINS protein PSF3 (Fragment) OS=Homo sapiens OX=9606 GN=GINS3 PE=2 SV=1
3	AFDB:Q7ZT01	0.872	0.896	2.079E-29	210	0.722	0.743	Q7ZT01.pdb.gz	PSF3_XENLA DNA replication complex GINS protein PSF3 OS=Xenopus laevis OX=8355 GN=gins3 PE=1 SV=1
4	PDB:6xtxC	0.838	0.929	5.740E-29	194	0.898	1.000	6xtxC.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
5	AFDB:F1QXM4	0.874	0.893	2.662E-28	211	0.662	0.678	F1QXM4.pdb.gz
6	AFDB:Q9W2V7	0.744	0.757	3.175E-13	212	0.264	0.269	Q9W2V7.pdb.gz	Q9W2V7_DROME DNA replication complex GINS protein PSF3 OS=Drosophila melanogaster OX=7227 GN=Psf3 PE=1 SV=1
7	AFDB:A0A0S2Z5L4	0.520	0.789	9.153E-12	138	0.625	0.978	A0A0S2Z5L4.pdb.gz	A0A0S2Z5L4_HUMAN DNA replication complex GINS protein PSF3 (Fragment) OS=Homo sapiens OX=9606 GN=GINS3 PE=2 SV=1
8	AFDB:Q6NNH6	0.691	0.799	5.518E-11	185	0.204	0.238	Q6NNH6.pdb.gz	Q6NNH6_ARATH At1g19080 OS=Arabidopsis thaliana OX=3702 GN=TTN10 PE=1 SV=1
9	AFDB:Q9UTC3	0.666	0.852	6.958E-11	166	0.208	0.271	Q9UTC3.pdb.gz	PSF3_SCHPO DNA replication complex GINS protein psf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psf3 PE=3 SV=1
10	AFDB:Q583F3	0.691	0.828	2.796E-10	178	0.213	0.258	Q583F3.pdb.gz	Q583F3_TRYB2 GINS subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.250 PE=3 SV=1
11	PDB:6sklC	0.662	0.796	1.738E-9	177	0.194	0.237	6sklC.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
12	AFDB:Q12146	0.667	0.738	2.840E-9	194	0.176	0.196	Q12146.pdb.gz	PSF3_YEAST DNA replication complex GINS protein PSF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSF3 PE=1 SV=2
13	PDB:6raxM	0.617	0.769	9.374E-5	167	0.241	0.311	6raxM.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
14	PDB:2ehoG	0.512	0.608	5.652E-4	176	0.130	0.159	2ehoG.pdb.gz
15	PDB:6sklB	0.424	0.465	1.292E-2	193	0.130	0.145	6sklB.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
16	PDB:6raxL	0.523	0.600	1.727E-2	185	0.125	0.146	6raxL.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
17	PDB:5ok9B	0.165	0.149	1.497	242	0.097	0.087	5ok9B.pdb.gz
18	PDB:7pubFh	0.166	0.147	1.888	274	0.065	0.051	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
19	PDB:1o0lA	0.188	0.212	2.246	188	0.074	0.085	1o0lA.pdb.gz
20	PDB:4j6sB	0.169	0.154	2.380	243	0.060	0.053	4j6sB.pdb.gz	The N-terminal sequence of tyrosine hydroxylase is a conformationally versatile motif that binds 14-3-3 proteins and membranes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5L0	5.38e-163	450	216	1.000	1.000	A0A0S2Z5L0_HUMAN DNA replication complex GINS protein PSF3 (Fragment) OS=Homo sapiens OX=9606 GN=GINS3 PE=2 SV=1
2	Q9BRX5	5.38e-163	450	216	1.000	1.000	PSF3_HUMAN DNA replication complex GINS protein PSF3 OS=Homo sapiens OX=9606 GN=GINS3 PE=1 SV=1
3	A0A0S2Z5P2	2.46e-154	429	255	1.000	0.847	A0A0S2Z5P2_HUMAN DNA replication complex GINS protein PSF3 (Fragment) OS=Homo sapiens OX=9606 GN=GINS3 PE=2 SV=1
4	Q7ZT01	3.90e-113	323	210	0.727	0.748	PSF3_XENLA DNA replication complex GINS protein PSF3 OS=Xenopus laevis OX=8355 GN=gins3 PE=1 SV=1
5	Q6DRM7	4.03e-106	306	211	0.657	0.673	Q6DRM7_DANRE DNA replication complex GINS protein PSF3 OS=Danio rerio OX=7955 GN=zgc:100834 PE=1 SV=1
6	A0A0S2Z5L4	1.58e-51	165	138	0.361	0.565	A0A0S2Z5L4_HUMAN DNA replication complex GINS protein PSF3 (Fragment) OS=Homo sapiens OX=9606 GN=GINS3 PE=2 SV=1
7	Q9W2V7	3.14e-22	92.0	212	0.301	0.307	Q9W2V7_DROME DNA replication complex GINS protein PSF3 OS=Drosophila melanogaster OX=7227 GN=Psf3 PE=1 SV=1
8	Q9UTC3	2.62e-16	75.5	166	0.218	0.283	PSF3_SCHPO DNA replication complex GINS protein psf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psf3 PE=3 SV=1
9	Q6NNH6	2.84e-14	70.5	185	0.227	0.265	Q6NNH6_ARATH At1g19080 OS=Arabidopsis thaliana OX=3702 GN=TTN10 PE=1 SV=1
10	Q12146	1.74e-09	57.4	194	0.213	0.237	PSF3_YEAST DNA replication complex GINS protein PSF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSF3 PE=1 SV=2
11	Q583F3	2.47e-09	56.6	178	0.222	0.270	Q583F3_TRYB2 GINS subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.250 PE=3 SV=1
12	F4JNR2	0.33	34.3	841	0.116	0.030	F4JNR2_ARATH CRS1 / YhbY (CRM) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g29750 PE=1 SV=1
13	B6HFX8	3.6	31.2	732	0.074	0.022	PCHDS_PENRW Conidiogenone synthase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PchDS PE=1 SV=1
14	Q9NU22	5.3	30.8	5596	0.083	0.003	MDN1_HUMAN Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2
15	P49641	5.6	30.4	1150	0.074	0.014	MA2A2_HUMAN Alpha-mannosidase 2x OS=Homo sapiens OX=9606 GN=MAN2A2 PE=2 SV=3
16	O88738	5.7	30.4	4882	0.102	0.005	BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus OX=10090 GN=Birc6 PE=1 SV=2
17	P38881	6.3	30.0	321	0.079	0.053	NVJ1_YEAST Nucleus-vacuole junction protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NVJ1 PE=1 SV=1
18	Q58AU4	6.9	30.0	919	0.106	0.025	Q58AU4_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=1
19	Q9NR09	7.4	30.0	4857	0.102	0.005	BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=3
20	A2Q7E0	7.9	30.0	628	0.065	0.022	ABFA_ASPNC Probable alpha-L-arabinofuranosidase A OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=abfA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05916 Sld5	1.9e-06	39.7	GINS complex protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003823756.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003805410.1	0.999	DNA replication complex GINS protein PSF1
2	9597.XP_003823349.1	0.999	The GINS complex plays an essential role in the initiation of DNA replication
3	9597.XP_008972633.1	0.999	DNA replication complex GINS protein PSF2
4	9597.XP_003815784.1	0.987	Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
5	9597.XP_008964895.1	0.987	Cell division cycle 45
6	9597.XP_003833207.1	0.986	Minichromosome maintenance complex component 3
7	9597.XP_008975132.1	0.985	Minichromosome maintenance complex component 4
8	9597.XP_003815290.1	0.982	Belongs to the MCM family
9	9597.XP_003821556.1	0.982	Minichromosome maintenance complex component 5
10	9597.XP_003831741.1	0.975	WD repeat and HMG-box DNA binding protein 1
11	9597.XP_008955363.1	0.945	DNA polymerase epsilon subunit 2 isoform X1
12	9597.XP_008951581.1	0.938	Plays an important role in the control of DNA replication and the maintenance of replication fork stability.
13	9597.XP_003822864.1	0.927	Minichromosome maintenance complex component 6
14	9597.XP_003824958.1	0.922	Timeless circadian clock
15	9597.XP_008951170.1	0.922	Minichromosome maintenance 9 homologous recombination repair factor
16	9597.XP_008965552.1	0.907	DNA polymerase II participates in chromosomal DNA replication
17	9597.XP_003831470.1	0.884	Involved in the initiation of DNA replication. Also participates in checkpoint controls that ensure DNA replication is completed before mitosis is initiated
18	9597.XP_008954060.1	0.850	Belongs to the protein kinase superfamily.
19	9597.XP_003821400.1	0.843	Minichromosome maintenance 8 homologous recombination repair factor
20	9597.XP_008954962.1	0.843	MCM domain-containing protein 2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006259	0.976	DNA metabolic process
GO:0006260	0.971	DNA replication
GO:0006275	0.574	regulation of DNA replication
GO:2000278	0.563	regulation of DNA biosynthetic process
GO:2000573	0.543	positive regulation of DNA biosynthetic process
GO:0051338	0.516	regulation of transferase activity
GO:0006261	0.474	DNA-templated DNA replication
GO:0032508	0.461	DNA duplex unwinding
GO:0090329	0.456	regulation of DNA-templated DNA replication
GO:0051347	0.442	positive regulation of transferase activity
GO:0006268	0.438	DNA unwinding involved in DNA replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000228	0.998	nuclear chromosome
GO:0032993	0.997	protein-DNA complex
GO:0140513	0.997	nuclear protein-containing complex
GO:0000811	0.848	GINS complex
GO:0071162	0.587	CMG complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]